Protein Family IF10014

Metagenome Isolate
251 Members
64 Samples
233 Scaffolds
239.18 Avg Length

🧬 Representative Sequence

ID
3300042652|Ga0466708_419296|Ga0466708_419296_204_1085
Length
293 aa
Sequence
MPLGEPLHHAGLKKEGTAARAMRHIDNPGKVAHFSRTFFTGGSVWNISVPCLKEPVMSTPHNSAEKGQIAETVLMPGDPLRAKFVAETYLENPVEFNRIRGMLGYTGAYRGKPVSVMGSGMGMPSIGIYSYELFKFFDVENIIRIGSAGGYAKTLNVYDVLLVSESYSESSYALYQNGFEGHVIKASETLNSRLRDSARKLNFPLIEGRVHSSDIFYRENSGPIPYWQKVRDEQNCLAVEMESFALFHNARIAGKKAACLLTISDGMAIAQATTAEEREKRFTAMMEIALGIL

πŸ“Š Sample Types

Isolate 7.2%
Metagenome 92.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 41.0%
Unclassified 31.1%
Kalotermitidae 18.0%
Passalidae 3.3%
Rhinotermitidae 3.3%
Termopsidae 3.3%

🌳 Taxonomy

Archaea 0
Bacteria 237
Eukaryota 0
Viruses 0
Unclassified 14

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
2 2718218155 Flavobacteriaceae bacterium UJ101 Isolate
3 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
4 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
5 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
6 2820639607 Unclassified Firmicutes Cu122P5bin9 Isolate Unclassified
7 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
8 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
9 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
10 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
11 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
12 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
13 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
14 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
15 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
16 2820306284 Unclassified Firmicutes Th196P1bin11 Isolate Unclassified
17 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
18 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
19 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
20 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
21 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
22 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
23 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
24 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
25 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
26 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
27 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
28 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
29 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
30 2820298281 Unclassified Firmicutes Th196P1bin9 Isolate Unclassified
31 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
32 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
33 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
34 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
35 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
36 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
37 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
38 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
39 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
40 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
41 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
42 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
43 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
44 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
45 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
46 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
47 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
48 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
49 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
50 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
51 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
52 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
53 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
54 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
55 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
56 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
57 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
58 2820590132 Unclassified Firmicutes Emb289P1bin84 Isolate Unclassified
59 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
60 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
61 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
62 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
63 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
64 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466703_203359 3300042636 Bacteria 1058
2 Ga0466707_041634 3300042601 Bacteria 70206
3 Ga0466714_102514 3300042603 Bacteria 3014
4 Ga0466714_128021 3300042603 Bacteria 3626
5 Ga0466714_145661 3300042603 Bacteria 1947
6 Ga0466722_089858 3300042609 Bacteria 8225
7 Ga0466722_260601 3300042609 Bacteria 2128
8 Ga0466698_206545 3300042610 Bacteria 2142
9 Ga0466698_410347 3300042610 Bacteria 1675
10 Ga0123355_10001433 3300009826 Bacteria 33186
11 Ga0123355_10030578 3300009826 Bacteria 8727
12 Ga0123355_10443458 3300009826 Bacteria 1642
13 Ga0123356_10357950 3300010049 Bacteria 1585
14 Ga0123356_10359709 3300010049 Bacteria 1582
15 Ga0123356_10673770 3300010049 Bacteria 1202
16 Ga0123353_10132041 3300010167 Bacteria 4006
17 Ga0123353_10873890 3300010167 Bacteria 1228
18 Ga0123353_10945807 3300010167 Bacteria 1166
19 Ga0466712_066012 3300042614 Bacteria 2315
20 Ga0466712_155540 3300042614 Bacteria 10157
21 Ga0466711_248526 3300042615 Bacteria 21611
22 Ga0466723_194192 3300042618 Bacteria 9536
23 Ga0466726_298820 3300042619 Bacteria 1301
24 Ga0466693_155889 3300042592 Bacteria 2800
25 Ga0466693_252011 3300042592 Bacteria 1123
26 Ga0466694_115287 3300042594 Bacteria 6353
27 Ga0466694_164187 3300042594 Bacteria 1083
28 Ga0466694_227775 3300042594 Bacteria 1630
29 Ga0466695_217119 3300042595 Bacteria 1070
30 Ga0466699_140511 3300042597 Bacteria 1613
31 Ga0466699_199572 3300042597 Bacteria 34648
32 IMNBL1DRAFT_c0006579 3300000062 Bacteria 6318
33 JGI24698J34947_10036624 3300002449 Bacteria 2553
34 JGI24695J34938_10008686 3300002450 Bacteria 5770
35 JGI24695J34938_10041403 3300002450 Bacteria 2068
36 JGI24699J35502_11122113 3300002509 Bacteria 3402
37 Ga0068305_10023684 3300005083 Bacteria 7826
38 Ga0466735_106023 3300042624 Bacteria 11746
39 Ga0466703_325210 3300042636 Bacteria 2419
40 Ga0466708_459066 3300042652 Bacteria 2927
41 Ga0466720_035542 3300042607 Bacteria 4167
42 Ga0123357_10157688 3300009784 Bacteria 2732
43 Ga0123355_10000543 3300009826 Bacteria 50713
44 Ga0123355_10183701 3300009826 Bacteria 3098
45 Ga0123356_10001967 3300010049 Bacteria 22245
46 Ga0123356_10444364 3300010049 Bacteria 1444
47 Ga0123356_10698691 3300010049 Bacteria 1183
48 Ga0123353_10009450 3300010167 Bacteria 13468
49 Ga0123353_10067749 3300010167 Bacteria 5732
50 Ga0123353_10196853 3300010167 Bacteria 3176
51 Ga0123353_10249500 3300010167 Bacteria 2750
52 Ga0123353_10363952 3300010167 Bacteria 2172
53 Ga0123353_10370149 3300010167 Bacteria 2149
54 Ga0123353_10539599 3300010167 Bacteria 1686
55 Ga0123353_10550859 3300010167 Bacteria 1664
56 Ga0466712_030959 3300042614 Bacteria 1577
57 Ga0466712_048722 3300042614 Bacteria 18693
58 Ga0466657_133792 3300042582 Bacteria 1081
59 Ga0466690_355143 3300042590 Bacteria 4044
60 Ga0466694_131718 3300042594 Bacteria 2463
61 Ga0466694_389579 3300042594 Bacteria 1915
62 Ga0466699_003739 3300042597 Bacteria 2378
63 Ga0466699_037483 3300042597 Bacteria 31779
64 JGI24698J34947_10006109 3300002449 Bacteria 6610
65 JGI24698J34947_10037664 3300002449 Unclassified 2511
66 JGI24695J34938_10005305 3300002450 Bacteria 8086
67 JGI24695J34938_10012698 3300002450 Bacteria 4455
68 Ga0466732_191985 3300042656 Bacteria 1649
69 Ga0466729_240186 3300042621 Bacteria 1371
70 Ga0466702_270820 3300042635 Bacteria 1092
71 Ga0466708_037590 3300042652 Bacteria 4885
72 Ga0466708_224922 3300042652 Bacteria 7595
73 Ga0466700_474991 3300042600 Bacteria 2063
74 Ga0466719_445652 3300042606 Bacteria 1150
75 Ga0466720_060762 3300042607 Bacteria 1715
76 Ga0466720_067705 3300042607 Bacteria 18756
77 Ga0466720_130937 3300042607 Bacteria 3328
78 Ga0123355_10007516 3300009826 Bacteria 16347
79 Ga0123355_10253071 3300009826 Bacteria 2476
80 Ga0123356_10075617 3300010049 Bacteria 3173
81 Ga0123356_10287333 3300010049 Bacteria 1743
82 Ga0123353_10411191 3300010167 Bacteria 2009
83 Ga0123353_10662140 3300010167 Unclassified 1475
84 Ga0466712_122508 3300042614 Unclassified 1809
85 Ga0466712_302711 3300042614 Bacteria 3556
86 Ga0466711_327348 3300042615 Bacteria 8940
87 Ga0466718_031449 3300042617 Bacteria 1282
88 Ga0415639_024068 3300038395 Bacteria 1799
89 Ga0466694_133468 3300042594 Bacteria 3366
90 Ga0466699_020170 3300042597 Bacteria 1418
91 Ga0466699_048407 3300042597 Bacteria 2034
92 Ga0466699_240665 3300042597 Bacteria 2421
93 2227485201 2225789004 Bacteria 4275
94 IMNBL1DRAFT_c0000638 3300000062 Bacteria 28044
95 JGI24698J34947_10009343 3300002449 Unclassified 5382
96 Ga0072941_1015770 3300005201 Bacteria 12849
97 Ga0466705_235709 3300042612 Bacteria 10181
98 Ga0466731_049404 3300042622 Bacteria 1073
99 Ga0466709_043613 3300042648 Bacteria 36261
100 Ga0466716_300475 3300042605 Bacteria 4651
101 Ga0466720_103332 3300042607 Bacteria 19536
102 Ga0466720_162399 3300042607 Bacteria 19296
103 Ga0123355_10035852 3300009826 Bacteria 8064
104 Ga0123356_10060415 3300010049 Bacteria 3537
105 Ga0123356_10982168 3300010049 Bacteria 1015
106 Ga0123356_11065012 3300010049 Bacteria 978
107 Ga0123353_10028986 3300010167 Bacteria 8521
108 Ga0123353_10108017 3300010167 Bacteria 4484
109 Ga0123353_10175231 3300010167 Bacteria 3401
110 Ga0123353_10186217 3300010167 Bacteria 3282
111 Ga0123353_10350002 3300010167 Bacteria 2227
112 Ga0123353_10391258 3300010167 Unclassified 2074
113 Ga0123353_10556789 3300010167 Bacteria 1652
114 Ga0123353_11030453 3300010167 Bacteria 1102
115 Ga0123354_10390866 3300010882 Bacteria 1189
116 Ga0466712_089760 3300042614 Bacteria 1520
117 Ga0466712_093947 3300042614 Bacteria 3120
118 Ga0466711_439302 3300042615 Bacteria 3161
119 Ga0415639_103312 3300038395 Bacteria 1497
120 Ga0466694_344317 3300042594 Bacteria 2663
121 2227470354 2225789004 Unclassified 930
122 IMNBL1DRAFT_c0000574 3300000062 Unclassified 29635
123 JGI24698J34947_10028638 3300002449 Bacteria 2949
124 JGI24698J34947_10035208 3300002449 Bacteria 2616
125 JGI24698J34947_10052401 3300002449 Bacteria 2047
126 JGI24698J34947_10056737 3300002449 Bacteria 1946
127 JGI24700J35501_10930568 3300002508 Bacteria 15843
128 Ga0072941_1027745 3300005201 Bacteria 14028
129 Ga0072941_1055231 3300005201 Bacteria 6030
130 Ga0072941_1056014 3300005201 Unclassified 3078
131 Ga0466732_076133 3300042656 Bacteria 15677
132 Ga0466709_201939 3300042648 Bacteria 14293
133 Ga0466722_052832 3300042609 Bacteria 18992
134 Ga0123355_10216895 3300009826 Bacteria 2760
135 Ga0123355_10629181 3300009826 Bacteria 1261
136 Ga0123353_10023258 3300010167 Bacteria 9377
137 Ga0123353_10231051 3300010167 Bacteria 2884
138 Ga0123353_10508771 3300010167 Bacteria 1752
139 Ga0123353_10642367 3300010167 Bacteria 1504
140 Ga0123353_10714012 3300010167 Bacteria 1404
141 Ga0123354_10078711 3300010882 Bacteria 4684
142 Ga0123354_10325518 3300010882 Bacteria 1410
143 Ga0466712_284061 3300042614 Bacteria 2719
144 Ga0264413_121524 3300024493 Bacteria 2531
145 Ga0415639_000642 3300038395 Bacteria 11125
146 Ga0466696_381362 3300042596 Bacteria 1437
147 Ga0466699_001104 3300042597 Bacteria 7447
148 IMNBL1DRAFT_c0098983 3300000062 Bacteria 787
149 JGI24698J34947_10010967 3300002449 Bacteria 4973
150 JGI24695J34938_10005105 3300002450 Bacteria 8328
151 JGI24695J34938_10086060 3300002450 Bacteria 1294
152 Ga0072941_1048470 3300005201 Bacteria 5384
153 Ga0466705_247045 3300042612 Bacteria 1806
154 Ga0466732_125209 3300042656 Bacteria 22857
155 Ga0466732_146338 3300042656 Bacteria 27148
156 Ga0466708_160705 3300042652 Bacteria 3673
157 Ga0466708_371410 3300042652 Bacteria 4295
158 Ga0466708_419296 3300042652 Bacteria 1449
159 Ga0466714_030263 3300042603 Bacteria 1665
160 Ga0466716_280333 3300042605 Unclassified 1443
161 Ga0466720_060904 3300042607 Bacteria 13154
162 Ga0466720_066447 3300042607 Bacteria 12747
163 Ga0466720_109732 3300042607 Bacteria 9099
164 Ga0466720_165845 3300042607 Bacteria 11928
165 Ga0123355_10324168 3300009826 Bacteria 2071
166 Ga0123356_10008916 3300010049 Bacteria 9928
167 Ga0123353_10013868 3300010167 Bacteria 11576
168 Ga0123353_10309998 3300010167 Unclassified 2403
169 Ga0123353_11102385 3300010167 Bacteria 1054
170 Ga0123354_10126136 3300010882 Bacteria 3268
171 Ga0123354_10294570 3300010882 Bacteria 1548
172 Ga0466712_186952 3300042614 Bacteria 20411
173 Ga0466712_191768 3300042614 Bacteria 3088
174 Ga0466726_270667 3300042619 Bacteria 9247
175 Ga0466728_144424 3300042620 Bacteria 2449
176 Ga0466699_425873 3300042597 Bacteria 2711
177 IMNBL1DRAFT_c0007368 3300000062 Bacteria 5807
178 JGI24698J34947_10042953 3300002449 Bacteria 2319
179 JGI24695J34938_10000068 3300002450 Bacteria 86379
180 JGI24695J34938_10011650 3300002450 Bacteria 4724
181 JGI24695J34938_10016936 3300002450 Bacteria 3690
182 Ga0072941_1005900 3300005201 Bacteria 1795
183 Ga0072941_1032367 3300005201 Bacteria 11566
184 Ga0466705_277753 3300042612 Bacteria 5449
185 Ga0466720_075845 3300042607 Unclassified 11150
186 Ga0466720_214336 3300042607 Bacteria 1982
187 Ga0466698_233900 3300042610 Bacteria 1368
188 Ga0466698_312478 3300042610 Unclassified 2333
189 Ga0123355_10026346 3300009826 Bacteria 9378
190 Ga0123355_10070045 3300009826 Bacteria 5635
191 Ga0123355_10320892 3300009826 Bacteria 2087
192 Ga0123356_10000842 3300010049 Bacteria 34101
193 Ga0123356_10327903 3300010049 Bacteria 1646
194 Ga0123356_10793103 3300010049 Bacteria 1118
195 Ga0123353_10005001 3300010167 Bacteria 17266
196 Ga0123353_10552517 3300010167 Bacteria 1660
197 Ga0466712_266055 3300042614 Bacteria 3535
198 Ga0466712_315350 3300042614 Bacteria 11372
199 Ga0466699_171355 3300042597 Bacteria 6109
200 Ga0466699_290660 3300042597 Bacteria 1294
201 Ga0466699_318857 3300042597 Bacteria 1554
202 Ga0466699_418297 3300042597 Bacteria 1065
203 JGI24698J34947_10019101 3300002449 Bacteria 3701
204 JGI24698J34947_10019362 3300002449 Bacteria 3671
205 JGI24698J34947_10020567 3300002449 Bacteria 3553
206 JGI24698J34947_10027216 3300002449 Bacteria 3035
207 JGI24695J34938_10001788 3300002450 Bacteria 17683
208 Ga0466700_127223 3300042600 Bacteria 1160
209 Ga0466714_097568 3300042603 Bacteria 1783
210 Ga0466722_193454 3300042609 Bacteria 6359
211 Ga0466698_380499 3300042610 Bacteria 1244
212 Ga0123355_10082383 3300009826 Bacteria 5132
213 Ga0123355_10251478 3300009826 Bacteria 2487
214 Ga0123356_10088249 3300010049 Bacteria 2948
215 Ga0123353_10003140 3300010167 Bacteria 20742
216 Ga0123353_10085927 3300010167 Bacteria 5066
217 Ga0123353_10186441 3300010167 Bacteria 3280
218 Ga0123353_10346013 3300010167 Bacteria 2243
219 Ga0123353_10549204 3300010167 Unclassified 1667
220 Ga0466712_152922 3300042614 Bacteria 2146
221 Ga0466728_186851 3300042620 Bacteria 5172
222 Ga0264413_103647 3300024493 Bacteria 10362
223 Ga0466699_069291 3300042597 Bacteria 2826
224 Ga0466699_376808 3300042597 Bacteria 2075
225 Ga0466699_397321 3300042597 Bacteria 2351
226 AustNasuHG_c1003589 3300000089 Bacteria 5603
227 AustNasuHG_c1004919 3300000089 Bacteria 4783
228 JGI24698J34947_10019975 3300002449 Unclassified 3610
229 JGI24698J34947_10064587 3300002449 Bacteria 1788
230 JGI24698J34947_10088349 3300002449 Bacteria 1430
231 JGI24700J35501_10929654 3300002508 Bacteria 9745
232 Ga0072941_1001886 3300005201 Bacteria 139305
233 Ga0072941_1056015 3300005201 Bacteria 3264

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01048 PNP_UDP_1 Phosphorylase superfamily 73 283 0.84

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.