Protein Family IF10014
Metagenome
Isolate
251
Members
64
Samples
233
Scaffolds
239.18
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_419296|Ga0466708_419296_204_1085
- Length
- 293 aa
- Sequence
- MPLGEPLHHAGLKKEGTAARAMRHIDNPGKVAHFSRTFFTGGSVWNISVPCLKEPVMSTPHNSAEKGQIAETVLMPGDPLRAKFVAETYLENPVEFNRIRGMLGYTGAYRGKPVSVMGSGMGMPSIGIYSYELFKFFDVENIIRIGSAGGYAKTLNVYDVLLVSESYSESSYALYQNGFEGHVIKASETLNSRLRDSARKLNFPLIEGRVHSSDIFYRENSGPIPYWQKVRDEQNCLAVEMESFALFHNARIAGKKAACLLTISDGMAIAQATTAEEREKRFTAMMEIALGIL
Sample Types
Isolate
7.2%
Metagenome
92.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.0%
Unclassified
31.1%
Kalotermitidae
18.0%
Passalidae
3.3%
Rhinotermitidae
3.3%
Termopsidae
3.3%
Taxonomy
Archaea
0
Bacteria
237
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 3 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 4 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 5 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 6 | 2820639607 | Unclassified Firmicutes Cu122P5bin9 | Isolate | Unclassified |
| 7 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 8 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 9 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 10 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 11 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 12 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 13 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 14 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 15 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 16 | 2820306284 | Unclassified Firmicutes Th196P1bin11 | Isolate | Unclassified |
| 17 | 2820602899 | Unclassified Firmicutes Emb289P1bin51 | Isolate | Unclassified |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 20 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 21 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 22 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 23 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 24 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 25 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 26 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 27 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 28 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 29 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 30 | 2820298281 | Unclassified Firmicutes Th196P1bin9 | Isolate | Unclassified |
| 31 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 32 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 33 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 34 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 35 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 36 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 37 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 38 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 39 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 40 | 2820690275 | Unclassified Firmicutes Co191P1bin72 | Isolate | Unclassified |
| 41 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 44 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 45 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 46 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 47 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 48 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 49 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 50 | 2820661146 | Unclassified Firmicutes Co191P3bin61 | Isolate | Unclassified |
| 51 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 52 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 53 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 54 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 55 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 56 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 57 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 58 | 2820590132 | Unclassified Firmicutes Emb289P1bin84 | Isolate | Unclassified |
| 59 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 60 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 61 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 62 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 63 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 64 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466703_203359 | 3300042636 | Bacteria | 1058 |
| 2 | Ga0466707_041634 | 3300042601 | Bacteria | 70206 |
| 3 | Ga0466714_102514 | 3300042603 | Bacteria | 3014 |
| 4 | Ga0466714_128021 | 3300042603 | Bacteria | 3626 |
| 5 | Ga0466714_145661 | 3300042603 | Bacteria | 1947 |
| 6 | Ga0466722_089858 | 3300042609 | Bacteria | 8225 |
| 7 | Ga0466722_260601 | 3300042609 | Bacteria | 2128 |
| 8 | Ga0466698_206545 | 3300042610 | Bacteria | 2142 |
| 9 | Ga0466698_410347 | 3300042610 | Bacteria | 1675 |
| 10 | Ga0123355_10001433 | 3300009826 | Bacteria | 33186 |
| 11 | Ga0123355_10030578 | 3300009826 | Bacteria | 8727 |
| 12 | Ga0123355_10443458 | 3300009826 | Bacteria | 1642 |
| 13 | Ga0123356_10357950 | 3300010049 | Bacteria | 1585 |
| 14 | Ga0123356_10359709 | 3300010049 | Bacteria | 1582 |
| 15 | Ga0123356_10673770 | 3300010049 | Bacteria | 1202 |
| 16 | Ga0123353_10132041 | 3300010167 | Bacteria | 4006 |
| 17 | Ga0123353_10873890 | 3300010167 | Bacteria | 1228 |
| 18 | Ga0123353_10945807 | 3300010167 | Bacteria | 1166 |
| 19 | Ga0466712_066012 | 3300042614 | Bacteria | 2315 |
| 20 | Ga0466712_155540 | 3300042614 | Bacteria | 10157 |
| 21 | Ga0466711_248526 | 3300042615 | Bacteria | 21611 |
| 22 | Ga0466723_194192 | 3300042618 | Bacteria | 9536 |
| 23 | Ga0466726_298820 | 3300042619 | Bacteria | 1301 |
| 24 | Ga0466693_155889 | 3300042592 | Bacteria | 2800 |
| 25 | Ga0466693_252011 | 3300042592 | Bacteria | 1123 |
| 26 | Ga0466694_115287 | 3300042594 | Bacteria | 6353 |
| 27 | Ga0466694_164187 | 3300042594 | Bacteria | 1083 |
| 28 | Ga0466694_227775 | 3300042594 | Bacteria | 1630 |
| 29 | Ga0466695_217119 | 3300042595 | Bacteria | 1070 |
| 30 | Ga0466699_140511 | 3300042597 | Bacteria | 1613 |
| 31 | Ga0466699_199572 | 3300042597 | Bacteria | 34648 |
| 32 | IMNBL1DRAFT_c0006579 | 3300000062 | Bacteria | 6318 |
| 33 | JGI24698J34947_10036624 | 3300002449 | Bacteria | 2553 |
| 34 | JGI24695J34938_10008686 | 3300002450 | Bacteria | 5770 |
| 35 | JGI24695J34938_10041403 | 3300002450 | Bacteria | 2068 |
| 36 | JGI24699J35502_11122113 | 3300002509 | Bacteria | 3402 |
| 37 | Ga0068305_10023684 | 3300005083 | Bacteria | 7826 |
| 38 | Ga0466735_106023 | 3300042624 | Bacteria | 11746 |
| 39 | Ga0466703_325210 | 3300042636 | Bacteria | 2419 |
| 40 | Ga0466708_459066 | 3300042652 | Bacteria | 2927 |
| 41 | Ga0466720_035542 | 3300042607 | Bacteria | 4167 |
| 42 | Ga0123357_10157688 | 3300009784 | Bacteria | 2732 |
| 43 | Ga0123355_10000543 | 3300009826 | Bacteria | 50713 |
| 44 | Ga0123355_10183701 | 3300009826 | Bacteria | 3098 |
| 45 | Ga0123356_10001967 | 3300010049 | Bacteria | 22245 |
| 46 | Ga0123356_10444364 | 3300010049 | Bacteria | 1444 |
| 47 | Ga0123356_10698691 | 3300010049 | Bacteria | 1183 |
| 48 | Ga0123353_10009450 | 3300010167 | Bacteria | 13468 |
| 49 | Ga0123353_10067749 | 3300010167 | Bacteria | 5732 |
| 50 | Ga0123353_10196853 | 3300010167 | Bacteria | 3176 |
| 51 | Ga0123353_10249500 | 3300010167 | Bacteria | 2750 |
| 52 | Ga0123353_10363952 | 3300010167 | Bacteria | 2172 |
| 53 | Ga0123353_10370149 | 3300010167 | Bacteria | 2149 |
| 54 | Ga0123353_10539599 | 3300010167 | Bacteria | 1686 |
| 55 | Ga0123353_10550859 | 3300010167 | Bacteria | 1664 |
| 56 | Ga0466712_030959 | 3300042614 | Bacteria | 1577 |
| 57 | Ga0466712_048722 | 3300042614 | Bacteria | 18693 |
| 58 | Ga0466657_133792 | 3300042582 | Bacteria | 1081 |
| 59 | Ga0466690_355143 | 3300042590 | Bacteria | 4044 |
| 60 | Ga0466694_131718 | 3300042594 | Bacteria | 2463 |
| 61 | Ga0466694_389579 | 3300042594 | Bacteria | 1915 |
| 62 | Ga0466699_003739 | 3300042597 | Bacteria | 2378 |
| 63 | Ga0466699_037483 | 3300042597 | Bacteria | 31779 |
| 64 | JGI24698J34947_10006109 | 3300002449 | Bacteria | 6610 |
| 65 | JGI24698J34947_10037664 | 3300002449 | Unclassified | 2511 |
| 66 | JGI24695J34938_10005305 | 3300002450 | Bacteria | 8086 |
| 67 | JGI24695J34938_10012698 | 3300002450 | Bacteria | 4455 |
| 68 | Ga0466732_191985 | 3300042656 | Bacteria | 1649 |
| 69 | Ga0466729_240186 | 3300042621 | Bacteria | 1371 |
| 70 | Ga0466702_270820 | 3300042635 | Bacteria | 1092 |
| 71 | Ga0466708_037590 | 3300042652 | Bacteria | 4885 |
| 72 | Ga0466708_224922 | 3300042652 | Bacteria | 7595 |
| 73 | Ga0466700_474991 | 3300042600 | Bacteria | 2063 |
| 74 | Ga0466719_445652 | 3300042606 | Bacteria | 1150 |
| 75 | Ga0466720_060762 | 3300042607 | Bacteria | 1715 |
| 76 | Ga0466720_067705 | 3300042607 | Bacteria | 18756 |
| 77 | Ga0466720_130937 | 3300042607 | Bacteria | 3328 |
| 78 | Ga0123355_10007516 | 3300009826 | Bacteria | 16347 |
| 79 | Ga0123355_10253071 | 3300009826 | Bacteria | 2476 |
| 80 | Ga0123356_10075617 | 3300010049 | Bacteria | 3173 |
| 81 | Ga0123356_10287333 | 3300010049 | Bacteria | 1743 |
| 82 | Ga0123353_10411191 | 3300010167 | Bacteria | 2009 |
| 83 | Ga0123353_10662140 | 3300010167 | Unclassified | 1475 |
| 84 | Ga0466712_122508 | 3300042614 | Unclassified | 1809 |
| 85 | Ga0466712_302711 | 3300042614 | Bacteria | 3556 |
| 86 | Ga0466711_327348 | 3300042615 | Bacteria | 8940 |
| 87 | Ga0466718_031449 | 3300042617 | Bacteria | 1282 |
| 88 | Ga0415639_024068 | 3300038395 | Bacteria | 1799 |
| 89 | Ga0466694_133468 | 3300042594 | Bacteria | 3366 |
| 90 | Ga0466699_020170 | 3300042597 | Bacteria | 1418 |
| 91 | Ga0466699_048407 | 3300042597 | Bacteria | 2034 |
| 92 | Ga0466699_240665 | 3300042597 | Bacteria | 2421 |
| 93 | 2227485201 | 2225789004 | Bacteria | 4275 |
| 94 | IMNBL1DRAFT_c0000638 | 3300000062 | Bacteria | 28044 |
| 95 | JGI24698J34947_10009343 | 3300002449 | Unclassified | 5382 |
| 96 | Ga0072941_1015770 | 3300005201 | Bacteria | 12849 |
| 97 | Ga0466705_235709 | 3300042612 | Bacteria | 10181 |
| 98 | Ga0466731_049404 | 3300042622 | Bacteria | 1073 |
| 99 | Ga0466709_043613 | 3300042648 | Bacteria | 36261 |
| 100 | Ga0466716_300475 | 3300042605 | Bacteria | 4651 |
| 101 | Ga0466720_103332 | 3300042607 | Bacteria | 19536 |
| 102 | Ga0466720_162399 | 3300042607 | Bacteria | 19296 |
| 103 | Ga0123355_10035852 | 3300009826 | Bacteria | 8064 |
| 104 | Ga0123356_10060415 | 3300010049 | Bacteria | 3537 |
| 105 | Ga0123356_10982168 | 3300010049 | Bacteria | 1015 |
| 106 | Ga0123356_11065012 | 3300010049 | Bacteria | 978 |
| 107 | Ga0123353_10028986 | 3300010167 | Bacteria | 8521 |
| 108 | Ga0123353_10108017 | 3300010167 | Bacteria | 4484 |
| 109 | Ga0123353_10175231 | 3300010167 | Bacteria | 3401 |
| 110 | Ga0123353_10186217 | 3300010167 | Bacteria | 3282 |
| 111 | Ga0123353_10350002 | 3300010167 | Bacteria | 2227 |
| 112 | Ga0123353_10391258 | 3300010167 | Unclassified | 2074 |
| 113 | Ga0123353_10556789 | 3300010167 | Bacteria | 1652 |
| 114 | Ga0123353_11030453 | 3300010167 | Bacteria | 1102 |
| 115 | Ga0123354_10390866 | 3300010882 | Bacteria | 1189 |
| 116 | Ga0466712_089760 | 3300042614 | Bacteria | 1520 |
| 117 | Ga0466712_093947 | 3300042614 | Bacteria | 3120 |
| 118 | Ga0466711_439302 | 3300042615 | Bacteria | 3161 |
| 119 | Ga0415639_103312 | 3300038395 | Bacteria | 1497 |
| 120 | Ga0466694_344317 | 3300042594 | Bacteria | 2663 |
| 121 | 2227470354 | 2225789004 | Unclassified | 930 |
| 122 | IMNBL1DRAFT_c0000574 | 3300000062 | Unclassified | 29635 |
| 123 | JGI24698J34947_10028638 | 3300002449 | Bacteria | 2949 |
| 124 | JGI24698J34947_10035208 | 3300002449 | Bacteria | 2616 |
| 125 | JGI24698J34947_10052401 | 3300002449 | Bacteria | 2047 |
| 126 | JGI24698J34947_10056737 | 3300002449 | Bacteria | 1946 |
| 127 | JGI24700J35501_10930568 | 3300002508 | Bacteria | 15843 |
| 128 | Ga0072941_1027745 | 3300005201 | Bacteria | 14028 |
| 129 | Ga0072941_1055231 | 3300005201 | Bacteria | 6030 |
| 130 | Ga0072941_1056014 | 3300005201 | Unclassified | 3078 |
| 131 | Ga0466732_076133 | 3300042656 | Bacteria | 15677 |
| 132 | Ga0466709_201939 | 3300042648 | Bacteria | 14293 |
| 133 | Ga0466722_052832 | 3300042609 | Bacteria | 18992 |
| 134 | Ga0123355_10216895 | 3300009826 | Bacteria | 2760 |
| 135 | Ga0123355_10629181 | 3300009826 | Bacteria | 1261 |
| 136 | Ga0123353_10023258 | 3300010167 | Bacteria | 9377 |
| 137 | Ga0123353_10231051 | 3300010167 | Bacteria | 2884 |
| 138 | Ga0123353_10508771 | 3300010167 | Bacteria | 1752 |
| 139 | Ga0123353_10642367 | 3300010167 | Bacteria | 1504 |
| 140 | Ga0123353_10714012 | 3300010167 | Bacteria | 1404 |
| 141 | Ga0123354_10078711 | 3300010882 | Bacteria | 4684 |
| 142 | Ga0123354_10325518 | 3300010882 | Bacteria | 1410 |
| 143 | Ga0466712_284061 | 3300042614 | Bacteria | 2719 |
| 144 | Ga0264413_121524 | 3300024493 | Bacteria | 2531 |
| 145 | Ga0415639_000642 | 3300038395 | Bacteria | 11125 |
| 146 | Ga0466696_381362 | 3300042596 | Bacteria | 1437 |
| 147 | Ga0466699_001104 | 3300042597 | Bacteria | 7447 |
| 148 | IMNBL1DRAFT_c0098983 | 3300000062 | Bacteria | 787 |
| 149 | JGI24698J34947_10010967 | 3300002449 | Bacteria | 4973 |
| 150 | JGI24695J34938_10005105 | 3300002450 | Bacteria | 8328 |
| 151 | JGI24695J34938_10086060 | 3300002450 | Bacteria | 1294 |
| 152 | Ga0072941_1048470 | 3300005201 | Bacteria | 5384 |
| 153 | Ga0466705_247045 | 3300042612 | Bacteria | 1806 |
| 154 | Ga0466732_125209 | 3300042656 | Bacteria | 22857 |
| 155 | Ga0466732_146338 | 3300042656 | Bacteria | 27148 |
| 156 | Ga0466708_160705 | 3300042652 | Bacteria | 3673 |
| 157 | Ga0466708_371410 | 3300042652 | Bacteria | 4295 |
| 158 | Ga0466708_419296 | 3300042652 | Bacteria | 1449 |
| 159 | Ga0466714_030263 | 3300042603 | Bacteria | 1665 |
| 160 | Ga0466716_280333 | 3300042605 | Unclassified | 1443 |
| 161 | Ga0466720_060904 | 3300042607 | Bacteria | 13154 |
| 162 | Ga0466720_066447 | 3300042607 | Bacteria | 12747 |
| 163 | Ga0466720_109732 | 3300042607 | Bacteria | 9099 |
| 164 | Ga0466720_165845 | 3300042607 | Bacteria | 11928 |
| 165 | Ga0123355_10324168 | 3300009826 | Bacteria | 2071 |
| 166 | Ga0123356_10008916 | 3300010049 | Bacteria | 9928 |
| 167 | Ga0123353_10013868 | 3300010167 | Bacteria | 11576 |
| 168 | Ga0123353_10309998 | 3300010167 | Unclassified | 2403 |
| 169 | Ga0123353_11102385 | 3300010167 | Bacteria | 1054 |
| 170 | Ga0123354_10126136 | 3300010882 | Bacteria | 3268 |
| 171 | Ga0123354_10294570 | 3300010882 | Bacteria | 1548 |
| 172 | Ga0466712_186952 | 3300042614 | Bacteria | 20411 |
| 173 | Ga0466712_191768 | 3300042614 | Bacteria | 3088 |
| 174 | Ga0466726_270667 | 3300042619 | Bacteria | 9247 |
| 175 | Ga0466728_144424 | 3300042620 | Bacteria | 2449 |
| 176 | Ga0466699_425873 | 3300042597 | Bacteria | 2711 |
| 177 | IMNBL1DRAFT_c0007368 | 3300000062 | Bacteria | 5807 |
| 178 | JGI24698J34947_10042953 | 3300002449 | Bacteria | 2319 |
| 179 | JGI24695J34938_10000068 | 3300002450 | Bacteria | 86379 |
| 180 | JGI24695J34938_10011650 | 3300002450 | Bacteria | 4724 |
| 181 | JGI24695J34938_10016936 | 3300002450 | Bacteria | 3690 |
| 182 | Ga0072941_1005900 | 3300005201 | Bacteria | 1795 |
| 183 | Ga0072941_1032367 | 3300005201 | Bacteria | 11566 |
| 184 | Ga0466705_277753 | 3300042612 | Bacteria | 5449 |
| 185 | Ga0466720_075845 | 3300042607 | Unclassified | 11150 |
| 186 | Ga0466720_214336 | 3300042607 | Bacteria | 1982 |
| 187 | Ga0466698_233900 | 3300042610 | Bacteria | 1368 |
| 188 | Ga0466698_312478 | 3300042610 | Unclassified | 2333 |
| 189 | Ga0123355_10026346 | 3300009826 | Bacteria | 9378 |
| 190 | Ga0123355_10070045 | 3300009826 | Bacteria | 5635 |
| 191 | Ga0123355_10320892 | 3300009826 | Bacteria | 2087 |
| 192 | Ga0123356_10000842 | 3300010049 | Bacteria | 34101 |
| 193 | Ga0123356_10327903 | 3300010049 | Bacteria | 1646 |
| 194 | Ga0123356_10793103 | 3300010049 | Bacteria | 1118 |
| 195 | Ga0123353_10005001 | 3300010167 | Bacteria | 17266 |
| 196 | Ga0123353_10552517 | 3300010167 | Bacteria | 1660 |
| 197 | Ga0466712_266055 | 3300042614 | Bacteria | 3535 |
| 198 | Ga0466712_315350 | 3300042614 | Bacteria | 11372 |
| 199 | Ga0466699_171355 | 3300042597 | Bacteria | 6109 |
| 200 | Ga0466699_290660 | 3300042597 | Bacteria | 1294 |
| 201 | Ga0466699_318857 | 3300042597 | Bacteria | 1554 |
| 202 | Ga0466699_418297 | 3300042597 | Bacteria | 1065 |
| 203 | JGI24698J34947_10019101 | 3300002449 | Bacteria | 3701 |
| 204 | JGI24698J34947_10019362 | 3300002449 | Bacteria | 3671 |
| 205 | JGI24698J34947_10020567 | 3300002449 | Bacteria | 3553 |
| 206 | JGI24698J34947_10027216 | 3300002449 | Bacteria | 3035 |
| 207 | JGI24695J34938_10001788 | 3300002450 | Bacteria | 17683 |
| 208 | Ga0466700_127223 | 3300042600 | Bacteria | 1160 |
| 209 | Ga0466714_097568 | 3300042603 | Bacteria | 1783 |
| 210 | Ga0466722_193454 | 3300042609 | Bacteria | 6359 |
| 211 | Ga0466698_380499 | 3300042610 | Bacteria | 1244 |
| 212 | Ga0123355_10082383 | 3300009826 | Bacteria | 5132 |
| 213 | Ga0123355_10251478 | 3300009826 | Bacteria | 2487 |
| 214 | Ga0123356_10088249 | 3300010049 | Bacteria | 2948 |
| 215 | Ga0123353_10003140 | 3300010167 | Bacteria | 20742 |
| 216 | Ga0123353_10085927 | 3300010167 | Bacteria | 5066 |
| 217 | Ga0123353_10186441 | 3300010167 | Bacteria | 3280 |
| 218 | Ga0123353_10346013 | 3300010167 | Bacteria | 2243 |
| 219 | Ga0123353_10549204 | 3300010167 | Unclassified | 1667 |
| 220 | Ga0466712_152922 | 3300042614 | Bacteria | 2146 |
| 221 | Ga0466728_186851 | 3300042620 | Bacteria | 5172 |
| 222 | Ga0264413_103647 | 3300024493 | Bacteria | 10362 |
| 223 | Ga0466699_069291 | 3300042597 | Bacteria | 2826 |
| 224 | Ga0466699_376808 | 3300042597 | Bacteria | 2075 |
| 225 | Ga0466699_397321 | 3300042597 | Bacteria | 2351 |
| 226 | AustNasuHG_c1003589 | 3300000089 | Bacteria | 5603 |
| 227 | AustNasuHG_c1004919 | 3300000089 | Bacteria | 4783 |
| 228 | JGI24698J34947_10019975 | 3300002449 | Unclassified | 3610 |
| 229 | JGI24698J34947_10064587 | 3300002449 | Bacteria | 1788 |
| 230 | JGI24698J34947_10088349 | 3300002449 | Bacteria | 1430 |
| 231 | JGI24700J35501_10929654 | 3300002508 | Bacteria | 9745 |
| 232 | Ga0072941_1001886 | 3300005201 | Bacteria | 139305 |
| 233 | Ga0072941_1056015 | 3300005201 | Bacteria | 3264 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01048 | PNP_UDP_1 | Phosphorylase superfamily | 73 | 283 | 0.84 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.