Protein Family IF09967
Metagenome
Isolate
197
Members
53
Samples
189
Scaffolds
290.33
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_300694|Ga0466708_300694_7389_8384
- Length
- 331 aa
- Sequence
- VKASSVKRLALGRGLERPVLGMAPECLEPAEKGGIMIVLHQLINGLSLGSIYALIALGYTMVYGIVLLINFAHGDILMVGAYTAFFVLGAAGPGPLGMFAAFVASALLCAVFGITIERLAYRPLRSAPRLNSLITAIAVSLILENGARVLPFIGPNPRQFPQPAVVTIDLGGGLSVSNIQIIVIVLSALLMLALNLLVNYTRRGKAMRAVSFDQGAASLMGISVNRVIAFTFALGSVLAAAGGVLYASAYPQVNPLMGMMPGLKAFVAAVLGGIGSIPGAMLGGFILGIAETMTKGFLSSQYSDAISFSILIIVLLIKPTGILGKKLNVKV
Sample Types
Isolate
4.1%
Metagenome
95.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.3%
Kalotermitidae
26.9%
Unclassified
17.3%
Rhinotermitidae
5.8%
Termopsidae
5.8%
Hodotermitidae
1.9%
Taxonomy
Archaea
0
Bacteria
176
Eukaryota
0
Viruses
0
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 2 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 3 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 8 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 11 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 12 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 13 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 14 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 15 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 16 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 19 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 20 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 21 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 22 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 23 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 24 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 25 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 26 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 27 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 28 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 29 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 30 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 31 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 32 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 33 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 34 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 37 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 38 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 39 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 40 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 41 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 42 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 43 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 44 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 45 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 46 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 47 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 48 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 49 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 50 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 51 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 52 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 53 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_101951 | 3300042612 | Bacteria | 11451 |
| 2 | Ga0466711_384308 | 3300042615 | Bacteria | 3127 |
| 3 | Ga0466718_037403 | 3300042617 | Bacteria | 33069 |
| 4 | Ga0466718_062280 | 3300042617 | Bacteria | 1364 |
| 5 | Ga0466723_091159 | 3300042618 | Bacteria | 15344 |
| 6 | Ga0466723_265950 | 3300042618 | Bacteria | 7471 |
| 7 | Ga0466726_046162 | 3300042619 | Bacteria | 6787 |
| 8 | Ga0466726_154022 | 3300042619 | Bacteria | 1449 |
| 9 | Ga0466726_252664 | 3300042619 | Bacteria | 2165 |
| 10 | Ga0466728_175081 | 3300042620 | Bacteria | 2890 |
| 11 | Ga0466734_047717 | 3300042623 | Bacteria | 1024 |
| 12 | Ga0466734_140872 | 3300042623 | Bacteria | 1492 |
| 13 | Ga0466704_180564 | 3300042643 | Bacteria | 35870 |
| 14 | Ga0466709_043357 | 3300042648 | Bacteria | 20072 |
| 15 | Ga0466708_051869 | 3300042652 | Bacteria | 3947 |
| 16 | Ga0466708_060787 | 3300042652 | Bacteria | 11369 |
| 17 | Ga0466708_134102 | 3300042652 | Bacteria | 4154 |
| 18 | Ga0466727_090020 | 3300042655 | Bacteria | 10792 |
| 19 | Ga0466690_144618 | 3300042590 | Bacteria | 1438 |
| 20 | Ga0466690_214466 | 3300042590 | Unclassified | 4250 |
| 21 | Ga0466691_057288 | 3300042593 | Bacteria | 3042 |
| 22 | Ga0466694_030604 | 3300042594 | Unclassified | 3229 |
| 23 | Ga0466696_205482 | 3300042596 | Bacteria | 15324 |
| 24 | Ga0466716_238682 | 3300042605 | Bacteria | 13996 |
| 25 | Ga0466719_107225 | 3300042606 | Unclassified | 1894 |
| 26 | Ga0466720_092111 | 3300042607 | Unclassified | 1182 |
| 27 | Ga0466722_122446 | 3300042609 | Bacteria | 10691 |
| 28 | JGI24695J34938_10019036 | 3300002450 | Bacteria | 3413 |
| 29 | Ga0466712_306328 | 3300042614 | Unclassified | 1889 |
| 30 | Ga0466718_117073 | 3300042617 | Bacteria | 8273 |
| 31 | Ga0466723_049330 | 3300042618 | Bacteria | 29056 |
| 32 | Ga0466726_009573 | 3300042619 | Bacteria | 2457 |
| 33 | Ga0466726_100664 | 3300042619 | Bacteria | 7024 |
| 34 | Ga0466726_307282 | 3300042619 | Bacteria | 1209 |
| 35 | Ga0466728_058412 | 3300042620 | Unclassified | 1258 |
| 36 | Ga0466728_116104 | 3300042620 | Bacteria | 6483 |
| 37 | Ga0466709_126954 | 3300042648 | Bacteria | 6950 |
| 38 | Ga0466708_139336 | 3300042652 | Bacteria | 48639 |
| 39 | Ga0466708_163304 | 3300042652 | Bacteria | 33834 |
| 40 | Ga0123357_10438849 | 3300009784 | Bacteria | 1145 |
| 41 | Ga0123356_10014268 | 3300010049 | Bacteria | 7643 |
| 42 | Ga0466691_119382 | 3300042593 | Bacteria | 6859 |
| 43 | Ga0466691_140233 | 3300042593 | Bacteria | 4821 |
| 44 | Ga0466691_140235 | 3300042593 | Bacteria | 7355 |
| 45 | Ga0466694_383733 | 3300042594 | Bacteria | 1981 |
| 46 | Ga0466696_302222 | 3300042596 | Bacteria | 5580 |
| 47 | Ga0466696_424335 | 3300042596 | Bacteria | 4967 |
| 48 | Ga0466700_475539 | 3300042600 | Bacteria | 6391 |
| 49 | Ga0466719_152423 | 3300042606 | Bacteria | 16922 |
| 50 | Ga0466720_043043 | 3300042607 | Unclassified | 2425 |
| 51 | Ga0466732_234843 | 3300042656 | Bacteria | 3069 |
| 52 | Ga0466732_369303 | 3300042656 | Bacteria | 1327 |
| 53 | Ga0466705_510487 | 3300042612 | Bacteria | 4277 |
| 54 | Ga0466712_116951 | 3300042614 | Bacteria | 17570 |
| 55 | Ga0466711_040360 | 3300042615 | Bacteria | 9484 |
| 56 | Ga0466711_201299 | 3300042615 | Bacteria | 38820 |
| 57 | Ga0466715_174494 | 3300042616 | Bacteria | 12675 |
| 58 | Ga0466715_349608 | 3300042616 | Bacteria | 7044 |
| 59 | Ga0466718_002188 | 3300042617 | Bacteria | 15261 |
| 60 | Ga0466718_099063 | 3300042617 | Bacteria | 2038 |
| 61 | Ga0466723_135943 | 3300042618 | Bacteria | 3049 |
| 62 | Ga0466726_274373 | 3300042619 | Unclassified | 4542 |
| 63 | Ga0466728_049539 | 3300042620 | Unclassified | 7517 |
| 64 | Ga0466735_039265 | 3300042624 | Bacteria | 2400 |
| 65 | Ga0466703_257371 | 3300042636 | Bacteria | 18409 |
| 66 | Ga0466704_268625 | 3300042643 | Bacteria | 59494 |
| 67 | Ga0466709_088976 | 3300042648 | Bacteria | 16281 |
| 68 | Ga0466709_296303 | 3300042648 | Bacteria | 26634 |
| 69 | Ga0466708_265181 | 3300042652 | Bacteria | 8979 |
| 70 | Ga0466708_300694 | 3300042652 | Bacteria | 12759 |
| 71 | Ga0466690_068664 | 3300042590 | Bacteria | 1860 |
| 72 | Ga0466696_316742 | 3300042596 | Bacteria | 3280 |
| 73 | Ga0466699_284454 | 3300042597 | Bacteria | 4223 |
| 74 | Ga0466707_276844 | 3300042601 | Bacteria | 5727 |
| 75 | Ga0466714_154842 | 3300042603 | Bacteria | 1142 |
| 76 | Ga0466716_086720 | 3300042605 | Bacteria | 4571 |
| 77 | AustNasuHG_c1012251 | 3300000089 | Bacteria | 2961 |
| 78 | JGI24698J34947_10008110 | 3300002449 | Bacteria | 5765 |
| 79 | Ga0466705_321325 | 3300042612 | Bacteria | 10416 |
| 80 | Ga0466733_063506 | 3300042659 | Bacteria | 3925 |
| 81 | Ga0466711_017640 | 3300042615 | Bacteria | 5281 |
| 82 | Ga0466715_031524 | 3300042616 | Bacteria | 20895 |
| 83 | Ga0466715_182927 | 3300042616 | Unclassified | 1492 |
| 84 | Ga0466718_080676 | 3300042617 | Bacteria | 4559 |
| 85 | Ga0466718_103056 | 3300042617 | Bacteria | 34191 |
| 86 | Ga0466726_150295 | 3300042619 | Unclassified | 2491 |
| 87 | Ga0466728_176584 | 3300042620 | Bacteria | 3796 |
| 88 | Ga0466703_022028 | 3300042636 | Bacteria | 12366 |
| 89 | Ga0466708_252715 | 3300042652 | Bacteria | 4353 |
| 90 | Ga0466727_300915 | 3300042655 | Bacteria | 2872 |
| 91 | Ga0123357_10005733 | 3300009784 | Bacteria | 14950 |
| 92 | Ga0123353_10816551 | 3300010167 | Bacteria | 1285 |
| 93 | Ga0123353_11191186 | 3300010167 | Unclassified | 1001 |
| 94 | Ga0466690_287972 | 3300042590 | Bacteria | 6211 |
| 95 | Ga0466692_020292 | 3300042591 | Bacteria | 4530 |
| 96 | Ga0466691_022054 | 3300042593 | Bacteria | 6880 |
| 97 | Ga0466691_048050 | 3300042593 | Unclassified | 2723 |
| 98 | Ga0466716_265588 | 3300042605 | Unclassified | 4905 |
| 99 | Ga0466719_141738 | 3300042606 | Bacteria | 2907 |
| 100 | AustNasuHG_c1000442 | 3300000089 | Bacteria | 14523 |
| 101 | JGI24698J34947_10000213 | 3300002449 | Bacteria | 23882 |
| 102 | JGI24695J34938_10007878 | 3300002450 | Bacteria | 6164 |
| 103 | JGI24702J35022_10002389 | 3300002462 | Bacteria | 11487 |
| 104 | Ga0466712_046872 | 3300042614 | Bacteria | 9838 |
| 105 | Ga0466715_183915 | 3300042616 | Unclassified | 2350 |
| 106 | Ga0466718_149843 | 3300042617 | Unclassified | 1322 |
| 107 | Ga0466704_545342 | 3300042643 | Bacteria | 14429 |
| 108 | Ga0466709_103928 | 3300042648 | Bacteria | 6052 |
| 109 | Ga0466709_129240 | 3300042648 | Bacteria | 2987 |
| 110 | Ga0466708_374433 | 3300042652 | Bacteria | 4323 |
| 111 | Ga0466708_420427 | 3300042652 | Bacteria | 1176 |
| 112 | Ga0123356_10506557 | 3300010049 | Bacteria | 1364 |
| 113 | Ga0466692_031136 | 3300042591 | Bacteria | 4762 |
| 114 | Ga0466692_035034 | 3300042591 | Bacteria | 1174 |
| 115 | Ga0466699_119978 | 3300042597 | Bacteria | 26184 |
| 116 | Ga0466716_015948 | 3300042605 | Bacteria | 8574 |
| 117 | Ga0466719_304044 | 3300042606 | Bacteria | 13674 |
| 118 | Ga0466722_060724 | 3300042609 | Bacteria | 12153 |
| 119 | AustNasuHG_c1006166 | 3300000089 | Unclassified | 4285 |
| 120 | JGI24695J34938_10007056 | 3300002450 | Bacteria | 6645 |
| 121 | Ga0466705_045297 | 3300042612 | Bacteria | 4793 |
| 122 | Ga0466705_326321 | 3300042612 | Unclassified | 1018 |
| 123 | Ga0466705_425315 | 3300042612 | Bacteria | 8908 |
| 124 | Ga0466711_030216 | 3300042615 | Bacteria | 14469 |
| 125 | Ga0466715_327556 | 3300042616 | Bacteria | 6013 |
| 126 | Ga0466715_414587 | 3300042616 | Bacteria | 17703 |
| 127 | Ga0466718_016770 | 3300042617 | Bacteria | 4687 |
| 128 | Ga0466723_194938 | 3300042618 | Bacteria | 4763 |
| 129 | Ga0466723_205487 | 3300042618 | Bacteria | 7760 |
| 130 | Ga0466723_273696 | 3300042618 | Bacteria | 7640 |
| 131 | Ga0466726_227272 | 3300042619 | Bacteria | 2519 |
| 132 | Ga0466703_245615 | 3300042636 | Bacteria | 7970 |
| 133 | Ga0466703_258157 | 3300042636 | Bacteria | 3331 |
| 134 | Ga0466704_494829 | 3300042643 | Bacteria | 21929 |
| 135 | Ga0466709_254776 | 3300042648 | Bacteria | 1253 |
| 136 | Ga0466709_274967 | 3300042648 | Bacteria | 1254 |
| 137 | Ga0123356_10121841 | 3300010049 | Bacteria | 2538 |
| 138 | Ga0466693_378756 | 3300042592 | Bacteria | 10021 |
| 139 | Ga0466691_014085 | 3300042593 | Bacteria | 15763 |
| 140 | Ga0466696_066795 | 3300042596 | Bacteria | 20973 |
| 141 | Ga0466716_187233 | 3300042605 | Bacteria | 6308 |
| 142 | Ga0466720_126859 | 3300042607 | Bacteria | 3687 |
| 143 | Ga0466722_008261 | 3300042609 | Bacteria | 3331 |
| 144 | Ga0466698_289982 | 3300042610 | Bacteria | 2060 |
| 145 | JGI24695J34938_10000164 | 3300002450 | Bacteria | 61824 |
| 146 | JGI24699J35502_11109291 | 3300002509 | Bacteria | 2627 |
| 147 | Ga0072941_1001351 | 3300005201 | Bacteria | 33692 |
| 148 | Ga0466732_251152 | 3300042656 | Bacteria | 12936 |
| 149 | Ga0466705_438321 | 3300042612 | Bacteria | 6150 |
| 150 | Ga0466711_451068 | 3300042615 | Bacteria | 23955 |
| 151 | Ga0466715_559060 | 3300042616 | Bacteria | 2226 |
| 152 | Ga0466723_052242 | 3300042618 | Bacteria | 24414 |
| 153 | Ga0466723_100064 | 3300042618 | Bacteria | 25786 |
| 154 | Ga0466723_159412 | 3300042618 | Bacteria | 5368 |
| 155 | Ga0466728_032303 | 3300042620 | Bacteria | 3767 |
| 156 | Ga0466729_063535 | 3300042621 | Bacteria | 1580 |
| 157 | Ga0466692_067993 | 3300042591 | Unclassified | 1479 |
| 158 | Ga0466692_083913 | 3300042591 | Bacteria | 1355 |
| 159 | Ga0466692_113761 | 3300042591 | Bacteria | 1041 |
| 160 | Ga0466692_151397 | 3300042591 | Bacteria | 15083 |
| 161 | Ga0466691_139147 | 3300042593 | Bacteria | 13177 |
| 162 | Ga0466716_341112 | 3300042605 | Bacteria | 6287 |
| 163 | Ga0466716_368582 | 3300042605 | Bacteria | 5893 |
| 164 | Ga0466722_106538 | 3300042609 | Bacteria | 8786 |
| 165 | AustNasuHG_c1003333 | 3300000089 | Bacteria | 5796 |
| 166 | JGI24695J34938_10004667 | 3300002450 | Bacteria | 8897 |
| 167 | Ga0074263_110455 | 3300005485 | Bacteria | 5569 |
| 168 | Ga0466705_172022 | 3300042612 | Bacteria | 22969 |
| 169 | Ga0466711_223051 | 3300042615 | Bacteria | 6846 |
| 170 | Ga0466715_003247 | 3300042616 | Bacteria | 3793 |
| 171 | Ga0466715_559985 | 3300042616 | Bacteria | 52926 |
| 172 | Ga0466723_075462 | 3300042618 | Bacteria | 18487 |
| 173 | Ga0466723_264634 | 3300042618 | Bacteria | 4404 |
| 174 | Ga0466729_216415 | 3300042621 | Unclassified | 2665 |
| 175 | Ga0466704_302462 | 3300042643 | Unclassified | 1234 |
| 176 | Ga0466708_175839 | 3300042652 | Bacteria | 10526 |
| 177 | Ga0466727_260997 | 3300042655 | Bacteria | 4783 |
| 178 | Ga0123354_10215242 | 3300010882 | Bacteria | 2061 |
| 179 | Ga0466690_413721 | 3300042590 | Bacteria | 7303 |
| 180 | Ga0466691_155306 | 3300042593 | Bacteria | 8318 |
| 181 | Ga0466691_224835 | 3300042593 | Bacteria | 7338 |
| 182 | Ga0466699_242977 | 3300042597 | Bacteria | 3025 |
| 183 | Ga0466699_393234 | 3300042597 | Bacteria | 1661 |
| 184 | Ga0466706_117630 | 3300042599 | Bacteria | 15050 |
| 185 | Ga0466720_004755 | 3300042607 | Bacteria | 4682 |
| 186 | JGI24698J34947_10006467 | 3300002449 | Bacteria | 6429 |
| 187 | JGI24702J35022_10149711 | 3300002462 | Bacteria | 1309 |
| 188 | Ga0072941_1001954 | 3300005201 | Bacteria | 13981 |
| 189 | Ga0072941_1007506 | 3300005201 | Bacteria | 17619 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02653 | BPD_transp_2 | Branched-chain amino acid transport system / permease component | 42 | 315 | 0.87 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.