Protein Family IF09962
Metagenome
Isolate
196
Members
62
Samples
180
Scaffolds
357.07
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_295393|Ga0466708_295393_135_1388
- Length
- 417 aa
- Sequence
- MKSQISGNGRLPGTTPQKTKNYSINSAVFPKPAGNRAFLFSFFPDIIKRYEKLVPACPGGFILMASASFFSDMLDSRFTPWADLDLSKTGKFLVISDFHMGGGRGDDLEYNGPLLCALLEQRYLEEGWHLVLHGDIEALQKYSLESIRSRWQNLYRIFDLFAAQNRFCKILGNHDETLVFEKGYPYPLYNVVRVETAFIPMYIYHGHQASRIYTNFNHLLRLSARYFLRPFGIHNISSYRNPYRRFYVEKQAYAFSLRNNCISIIGHTHRPLFESLGRFDYIKFEIERLCRDYPSAMPADQARIREEVRALRADLGKLKRSERRDVLRQSLYGDEIPVPCLFNSGCAIGRMGVYALEVDRETISLVYWFTEGAARKFINRGWYSIEELPGTRHRRVVLNRDRLDYIQARIELLGTPE
Sample Types
Isolate
8.2%
Metagenome
91.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.0%
Unclassified
31.7%
Kalotermitidae
23.3%
Termopsidae
5.0%
Rhinotermitidae
3.3%
Hodotermitidae
1.7%
Taxonomy
Archaea
0
Bacteria
190
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 2 | 2820023741 | Unclassified Spirochaetes Lab288P3bin165 | Isolate | Unclassified |
| 3 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 4 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 5 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 6 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 7 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 8 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 11 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 12 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 13 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 14 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 15 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 16 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 17 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 18 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 19 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 20 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 21 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 22 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 23 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 27 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 28 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 29 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 30 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 31 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 32 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 33 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 34 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 35 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 36 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 37 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 38 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 39 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 40 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 41 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 42 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 43 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 44 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 45 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 46 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 47 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 48 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 49 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 50 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 51 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 52 | 2820027804 | Unclassified Spirochaetes Lab288P1bin105 | Isolate | Unclassified |
| 53 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 54 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 55 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 56 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 57 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 58 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 59 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 60 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 61 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 62 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_382113 | 3300042656 | Bacteria | 18383 |
| 2 | Ga0466706_099739 | 3300042599 | Bacteria | 2067 |
| 3 | Ga0466707_021408 | 3300042601 | Bacteria | 2379 |
| 4 | Ga0466720_053201 | 3300042607 | Bacteria | 23315 |
| 5 | Ga0466722_082350 | 3300042609 | Bacteria | 4775 |
| 6 | Ga0466722_166454 | 3300042609 | Bacteria | 10490 |
| 7 | Ga0466705_392962 | 3300042612 | Bacteria | 2951 |
| 8 | Ga0466712_220252 | 3300042614 | Bacteria | 7552 |
| 9 | Ga0466712_276900 | 3300042614 | Bacteria | 27524 |
| 10 | Ga0466711_159473 | 3300042615 | Bacteria | 7483 |
| 11 | Ga0466715_417255 | 3300042616 | Bacteria | 7156 |
| 12 | Ga0123356_10016074 | 3300010049 | Bacteria | 7152 |
| 13 | Ga0123354_10021106 | 3300010882 | Bacteria | 10261 |
| 14 | Ga0466692_039053 | 3300042591 | Bacteria | 10267 |
| 15 | Ga0466694_086094 | 3300042594 | Bacteria | 23416 |
| 16 | Ga0466694_139847 | 3300042594 | Bacteria | 19575 |
| 17 | Ga0466699_170788 | 3300042597 | Bacteria | 3429 |
| 18 | Ga0466699_263505 | 3300042597 | Bacteria | 10346 |
| 19 | Ga0466731_436042 | 3300042622 | Bacteria | 4555 |
| 20 | JGI24698J34947_10103307 | 3300002449 | Bacteria | 1275 |
| 21 | JGI24695J34938_10000016 | 3300002450 | Bacteria | 116336 |
| 22 | JGI24695J34938_10007782 | 3300002450 | Bacteria | 6209 |
| 23 | Ga0466722_070642 | 3300042609 | Bacteria | 1629 |
| 24 | Ga0466715_328830 | 3300042616 | Bacteria | 30843 |
| 25 | Ga0466715_475280 | 3300042616 | Bacteria | 3382 |
| 26 | Ga0466726_466276 | 3300042619 | Bacteria | 2267 |
| 27 | Ga0466728_215584 | 3300042620 | Bacteria | 35980 |
| 28 | Ga0123356_10000264 | 3300010049 | Bacteria | 60568 |
| 29 | Ga0123356_10001628 | 3300010049 | Bacteria | 24648 |
| 30 | Ga0466696_040882 | 3300042596 | Bacteria | 10782 |
| 31 | Ga0466696_172318 | 3300042596 | Bacteria | 1691 |
| 32 | Ga0466699_003210 | 3300042597 | Bacteria | 2011 |
| 33 | Ga0466704_131011 | 3300042643 | Bacteria | 7065 |
| 34 | Ga0466708_220073 | 3300042652 | Bacteria | 4928 |
| 35 | AustNasuHG_c1012664 | 3300000089 | Bacteria | 2909 |
| 36 | Ga0466705_189835 | 3300042612 | Bacteria | 4916 |
| 37 | Ga0466705_266113 | 3300042612 | Bacteria | 67009 |
| 38 | Ga0466713_140180 | 3300042602 | Unclassified | 1840 |
| 39 | Ga0466716_087643 | 3300042605 | Bacteria | 24320 |
| 40 | Ga0466719_005782 | 3300042606 | Unclassified | 1581 |
| 41 | Ga0466720_238860 | 3300042607 | Bacteria | 102895 |
| 42 | Ga0466698_046877 | 3300042610 | Bacteria | 1418 |
| 43 | Ga0466712_206303 | 3300042614 | Bacteria | 3438 |
| 44 | Ga0466715_214768 | 3300042616 | Bacteria | 3836 |
| 45 | Ga0466723_142627 | 3300042618 | Bacteria | 9330 |
| 46 | Ga0466726_479512 | 3300042619 | Bacteria | 2890 |
| 47 | Ga0466728_126320 | 3300042620 | Bacteria | 1684 |
| 48 | Ga0123355_10091776 | 3300009826 | Bacteria | 4813 |
| 49 | Ga0466690_040531 | 3300042590 | Bacteria | 13360 |
| 50 | Ga0466692_077321 | 3300042591 | Bacteria | 4189 |
| 51 | Ga0466691_155398 | 3300042593 | Bacteria | 2147 |
| 52 | Ga0466691_158049 | 3300042593 | Bacteria | 1318 |
| 53 | Ga0466699_030228 | 3300042597 | Bacteria | 5852 |
| 54 | Ga0466699_102561 | 3300042597 | Bacteria | 8395 |
| 55 | Ga0466699_253585 | 3300042597 | Unclassified | 1137 |
| 56 | Ga0466708_167010 | 3300042652 | Bacteria | 9765 |
| 57 | Ga0466727_322355 | 3300042655 | Bacteria | 20773 |
| 58 | JGI24695J34938_10007766 | 3300002450 | Bacteria | 6215 |
| 59 | Ga0068305_10292446 | 3300005083 | Bacteria | 9961 |
| 60 | Ga0072941_1102666 | 3300005201 | Bacteria | 5625 |
| 61 | Ga0466733_117030 | 3300042659 | Bacteria | 1659 |
| 62 | Ga0466722_015000 | 3300042609 | Bacteria | 11154 |
| 63 | Ga0466722_015416 | 3300042609 | Bacteria | 6021 |
| 64 | Ga0466722_055765 | 3300042609 | Bacteria | 9262 |
| 65 | Ga0466722_180837 | 3300042609 | Bacteria | 11935 |
| 66 | Ga0466718_133077 | 3300042617 | Bacteria | 67767 |
| 67 | Ga0466723_005863 | 3300042618 | Bacteria | 10321 |
| 68 | Ga0466728_014175 | 3300042620 | Bacteria | 3271 |
| 69 | Ga0123356_10004686 | 3300010049 | Bacteria | 14080 |
| 70 | Ga0466692_201539 | 3300042591 | Bacteria | 3509 |
| 71 | Ga0466694_169580 | 3300042594 | Bacteria | 12464 |
| 72 | Ga0466699_026652 | 3300042597 | Bacteria | 5858 |
| 73 | Ga0466699_085186 | 3300042597 | Bacteria | 1981 |
| 74 | Ga0466699_374794 | 3300042597 | Bacteria | 4977 |
| 75 | Ga0466704_140178 | 3300042643 | Bacteria | 60046 |
| 76 | Ga0466709_027715 | 3300042648 | Bacteria | 1617 |
| 77 | Ga0466708_295393 | 3300042652 | Bacteria | 2240 |
| 78 | AustNasuHG_c1002674 | 3300000089 | Bacteria | 6441 |
| 79 | AustNasuHG_c1008661 | 3300000089 | Unclassified | 3599 |
| 80 | JGI24698J34947_10005147 | 3300002449 | Bacteria | 7164 |
| 81 | JGI24695J34938_10032224 | 3300002450 | Bacteria | 2423 |
| 82 | JGI24695J34938_10044749 | 3300002450 | Bacteria | 1967 |
| 83 | Ga0072940_1047586 | 3300005200 | Bacteria | 2070 |
| 84 | Ga0072941_1024765 | 3300005201 | Bacteria | 6926 |
| 85 | Ga0466698_051275 | 3300042610 | Unclassified | 1591 |
| 86 | Ga0466712_105809 | 3300042614 | Bacteria | 6592 |
| 87 | Ga0466712_222354 | 3300042614 | Bacteria | 29962 |
| 88 | Ga0466726_346823 | 3300042619 | Bacteria | 2623 |
| 89 | Ga0123355_10134478 | 3300009826 | Bacteria | 3800 |
| 90 | Ga0123356_10026020 | 3300010049 | Bacteria | 5500 |
| 91 | Ga0123353_10002009 | 3300010167 | Bacteria | 25145 |
| 92 | Ga0123353_10180994 | 3300010167 | Bacteria | 3337 |
| 93 | Ga0415639_042883 | 3300038395 | Bacteria | 9963 |
| 94 | Ga0466692_000048 | 3300042591 | Bacteria | 8574 |
| 95 | Ga0466694_080957 | 3300042594 | Bacteria | 3050 |
| 96 | Ga0466694_112678 | 3300042594 | Bacteria | 1668 |
| 97 | Ga0466699_257644 | 3300042597 | Bacteria | 9755 |
| 98 | Ga0466703_241216 | 3300042636 | Bacteria | 2620 |
| 99 | Ga0466704_242622 | 3300042643 | Bacteria | 1773 |
| 100 | Ga0466704_373248 | 3300042643 | Bacteria | 4882 |
| 101 | Ga0466727_057285 | 3300042655 | Bacteria | 9296 |
| 102 | AustNasuHG_c1011202 | 3300000089 | Bacteria | 3110 |
| 103 | JGI24698J34947_10007930 | 3300002449 | Bacteria | 5832 |
| 104 | JGI24698J34947_10027503 | 3300002449 | Bacteria | 3017 |
| 105 | JGI24698J34947_10048742 | 3300002449 | Bacteria | 2143 |
| 106 | JGI24695J34938_10000031 | 3300002450 | Bacteria | 105176 |
| 107 | JGI24695J34938_10074658 | 3300002450 | Bacteria | 1410 |
| 108 | Ga0072941_1028887 | 3300005201 | Bacteria | 19122 |
| 109 | Ga0466707_386706 | 3300042601 | Bacteria | 3165 |
| 110 | Ga0466716_151056 | 3300042605 | Bacteria | 2363 |
| 111 | Ga0466719_528823 | 3300042606 | Bacteria | 4466 |
| 112 | Ga0466722_174543 | 3300042609 | Bacteria | 6793 |
| 113 | Ga0466722_230071 | 3300042609 | Bacteria | 9442 |
| 114 | Ga0466718_040599 | 3300042617 | Bacteria | 11063 |
| 115 | Ga0466723_181730 | 3300042618 | Bacteria | 2332 |
| 116 | Ga0466723_257819 | 3300042618 | Bacteria | 13810 |
| 117 | Ga0466726_008193 | 3300042619 | Bacteria | 2323 |
| 118 | Ga0466726_310394 | 3300042619 | Bacteria | 1440 |
| 119 | Ga0123356_10495627 | 3300010049 | Bacteria | 1377 |
| 120 | Ga0123353_10115147 | 3300010167 | Bacteria | 4328 |
| 121 | Ga0264413_133412 | 3300024493 | Bacteria | 1443 |
| 122 | Ga0415639_000455 | 3300038395 | Bacteria | 14447 |
| 123 | Ga0415639_012800 | 3300038395 | Bacteria | 1477 |
| 124 | Ga0466691_014189 | 3300042593 | Bacteria | 5105 |
| 125 | Ga0466691_055505 | 3300042593 | Bacteria | 18967 |
| 126 | Ga0466699_117413 | 3300042597 | Bacteria | 2159 |
| 127 | Ga0466735_112516 | 3300042624 | Bacteria | 2494 |
| 128 | Ga0466703_049913 | 3300042636 | Bacteria | 15746 |
| 129 | Ga0466709_258556 | 3300042648 | Bacteria | 37873 |
| 130 | Ga0466708_041843 | 3300042652 | Bacteria | 23218 |
| 131 | Ga0466708_334651 | 3300042652 | Bacteria | 78030 |
| 132 | JGI24695J34938_10000012 | 3300002450 | Bacteria | 126955 |
| 133 | JGI24695J34938_10040666 | 3300002450 | Bacteria | 2092 |
| 134 | JGI24695J34938_10071912 | 3300002450 | Bacteria | 1444 |
| 135 | Ga0466733_018340 | 3300042659 | Bacteria | 1562 |
| 136 | Ga0466733_141867 | 3300042659 | Bacteria | 123412 |
| 137 | Ga0466707_344354 | 3300042601 | Bacteria | 15444 |
| 138 | Ga0466722_064604 | 3300042609 | Bacteria | 35013 |
| 139 | Ga0466698_093850 | 3300042610 | Bacteria | 4252 |
| 140 | Ga0466712_022445 | 3300042614 | Bacteria | 9404 |
| 141 | Ga0466715_214745 | 3300042616 | Bacteria | 4451 |
| 142 | Ga0466718_071922 | 3300042617 | Bacteria | 2930 |
| 143 | Ga0466726_355133 | 3300042619 | Bacteria | 2046 |
| 144 | Ga0466726_387900 | 3300042619 | Bacteria | 4086 |
| 145 | Ga0123356_10007825 | 3300010049 | Bacteria | 10645 |
| 146 | Ga0123353_10013914 | 3300010167 | Bacteria | 11565 |
| 147 | Ga0466690_052620 | 3300042590 | Bacteria | 10154 |
| 148 | Ga0466693_435930 | 3300042592 | Bacteria | 1309 |
| 149 | Ga0466694_383358 | 3300042594 | Bacteria | 7563 |
| 150 | Ga0466695_093378 | 3300042595 | Bacteria | 14476 |
| 151 | Ga0466699_251864 | 3300042597 | Bacteria | 59491 |
| 152 | Ga0466699_363141 | 3300042597 | Bacteria | 4692 |
| 153 | Ga0466703_124672 | 3300042636 | Bacteria | 11654 |
| 154 | Ga0466703_350923 | 3300042636 | Bacteria | 2201 |
| 155 | Ga0466704_103552 | 3300042643 | Bacteria | 2852 |
| 156 | Ga0466704_313215 | 3300042643 | Bacteria | 29544 |
| 157 | Ga0466708_370495 | 3300042652 | Bacteria | 4874 |
| 158 | Ga0466708_394234 | 3300042652 | Bacteria | 4475 |
| 159 | Ga0466727_262225 | 3300042655 | Unclassified | 2194 |
| 160 | JGI24698J34947_10014926 | 3300002449 | Bacteria | 4229 |
| 161 | JGI24698J34947_10096231 | 3300002449 | Bacteria | 1343 |
| 162 | JGI24695J34938_10002857 | 3300002450 | Bacteria | 12586 |
| 163 | JGI24695J34938_10008874 | 3300002450 | Bacteria | 5679 |
| 164 | Ga0466705_087237 | 3300042612 | Bacteria | 2251 |
| 165 | Ga0466732_300817 | 3300042656 | Bacteria | 1458 |
| 166 | Ga0466706_209677 | 3300042599 | Bacteria | 1338 |
| 167 | Ga0466716_123592 | 3300042605 | Bacteria | 1915 |
| 168 | Ga0466712_067748 | 3300042614 | Bacteria | 5000 |
| 169 | Ga0466711_058612 | 3300042615 | Bacteria | 1915 |
| 170 | Ga0466723_023395 | 3300042618 | Bacteria | 2917 |
| 171 | Ga0123353_10000346 | 3300010167 | Bacteria | 56678 |
| 172 | Ga0415639_149081 | 3300038395 | Bacteria | 1899 |
| 173 | Ga0466690_120581 | 3300042590 | Bacteria | 5384 |
| 174 | Ga0466693_157196 | 3300042592 | Bacteria | 53244 |
| 175 | Ga0466699_289164 | 3300042597 | Bacteria | 9734 |
| 176 | Ga0466702_332782 | 3300042635 | Bacteria | 6987 |
| 177 | Ga0466704_051511 | 3300042643 | Bacteria | 2347 |
| 178 | JGI24698J34947_10001101 | 3300002449 | Bacteria | 13934 |
| 179 | JGI24698J34947_10108211 | 3300002449 | Bacteria | 1233 |
| 180 | JGI24695J34938_10013961 | 3300002450 | Bacteria | 4192 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.