Protein Family IF09958
Metagenome
Isolate
224
Members
58
Samples
212
Scaffolds
92.49
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_288804|Ga0466708_288804_4823_5170
- Length
- 115 aa
- Sequence
- LFPLFPRLFFDKLKRFQIAMEWFMEWRASHILVKDRGLAEDLLRRVKQGAQFESLAREFSTCPSKSSGGDLGWFGPGKMVPAFESAVKRLSPGSVGDVVQTQFGYHIIKCTGRKE
Sample Types
Isolate
5.4%
Metagenome
94.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.1%
Kalotermitidae
25.0%
Unclassified
19.6%
Rhinotermitidae
7.1%
Termopsidae
5.4%
Blaberidae
1.8%
Taxonomy
Archaea
0
Bacteria
189
Eukaryota
0
Viruses
0
Unclassified
35
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 2 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 7 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 8 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 9 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 13 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 14 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 17 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 18 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 19 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 20 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 21 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 24 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 25 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 26 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 27 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 28 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 29 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 30 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 31 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 32 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 33 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 34 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 35 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 36 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 37 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 38 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 39 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 40 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 41 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 42 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 43 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 44 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 45 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 46 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 47 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 48 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 49 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 50 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 51 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 52 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 53 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 54 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 55 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 56 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 57 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 58 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_113548 | 3300042615 | Bacteria | 36298 |
| 2 | Ga0466711_174679 | 3300042615 | Unclassified | 5173 |
| 3 | Ga0466715_534972 | 3300042616 | Bacteria | 7927 |
| 4 | Ga0466723_116455 | 3300042618 | Bacteria | 47618 |
| 5 | Ga0123355_10016787 | 3300009826 | Bacteria | 11551 |
| 6 | Ga0466690_193029 | 3300042590 | Unclassified | 2705 |
| 7 | Ga0466692_107578 | 3300042591 | Bacteria | 3280 |
| 8 | Ga0466694_048441 | 3300042594 | Bacteria | 1145 |
| 9 | Ga0466699_177243 | 3300042597 | Bacteria | 2469 |
| 10 | Ga0466699_428773 | 3300042597 | Bacteria | 1135 |
| 11 | Ga0466699_440015 | 3300042597 | Bacteria | 32912 |
| 12 | JGI24698J34947_10014338 | 3300002449 | Bacteria | 4316 |
| 13 | JGI24705J35276_11386596 | 3300002504 | Bacteria | 524 |
| 14 | JGI24696J40584_12780515 | 3300002834 | Bacteria | 836 |
| 15 | Ga0466716_429805 | 3300042605 | Bacteria | 2866 |
| 16 | Ga0466719_155011 | 3300042606 | Unclassified | 1508 |
| 17 | Ga0466719_185730 | 3300042606 | Bacteria | 4286 |
| 18 | Ga0466708_013823 | 3300042652 | Bacteria | 15268 |
| 19 | Ga0466708_166271 | 3300042652 | Bacteria | 8181 |
| 20 | Ga0466708_282944 | 3300042652 | Bacteria | 3993 |
| 21 | Ga0466727_034103 | 3300042655 | Bacteria | 7989 |
| 22 | Ga0466727_215128 | 3300042655 | Bacteria | 4740 |
| 23 | Ga0466705_022414 | 3300042612 | Bacteria | 6080 |
| 24 | Ga0466705_267853 | 3300042612 | Bacteria | 2529 |
| 25 | Ga0466732_426902 | 3300042656 | Bacteria | 1431 |
| 26 | Ga0466712_265921 | 3300042614 | Bacteria | 33911 |
| 27 | Ga0466711_315344 | 3300042615 | Bacteria | 2968 |
| 28 | Ga0466715_132252 | 3300042616 | Bacteria | 6558 |
| 29 | Ga0466726_018621 | 3300042619 | Unclassified | 3643 |
| 30 | Ga0466726_467666 | 3300042619 | Unclassified | 1167 |
| 31 | Ga0466728_285568 | 3300042620 | Bacteria | 2794 |
| 32 | Ga0466692_133263 | 3300042591 | Bacteria | 4837 |
| 33 | Ga0466693_244071 | 3300042592 | Bacteria | 1252 |
| 34 | Ga0466691_034073 | 3300042593 | Bacteria | 13982 |
| 35 | Ga0466696_291808 | 3300042596 | Bacteria | 1318 |
| 36 | JGI24698J34947_10013089 | 3300002449 | Bacteria | 4532 |
| 37 | JGI24695J34938_10277291 | 3300002450 | Bacteria | 718 |
| 38 | Ga0466707_169637 | 3300042601 | Bacteria | 1613 |
| 39 | Ga0466716_251447 | 3300042605 | Unclassified | 3052 |
| 40 | Ga0466719_006981 | 3300042606 | Unclassified | 1192 |
| 41 | Ga0466719_041739 | 3300042606 | Bacteria | 6726 |
| 42 | Ga0466720_130785 | 3300042607 | Bacteria | 14484 |
| 43 | Ga0466722_153691 | 3300042609 | Bacteria | 7741 |
| 44 | Ga0466731_102213 | 3300042622 | Bacteria | 1245 |
| 45 | Ga0466704_245908 | 3300042643 | Bacteria | 5553 |
| 46 | Ga0466708_029503 | 3300042652 | Unclassified | 19353 |
| 47 | Ga0466727_259183 | 3300042655 | Bacteria | 2283 |
| 48 | Ga0466727_316814 | 3300042655 | Unclassified | 1481 |
| 49 | Ga0466727_345077 | 3300042655 | Bacteria | 5699 |
| 50 | Ga0466705_349446 | 3300042612 | Bacteria | 1337 |
| 51 | Ga0466711_145919 | 3300042615 | Bacteria | 2529 |
| 52 | Ga0466711_197249 | 3300042615 | Bacteria | 6943 |
| 53 | Ga0466715_063066 | 3300042616 | Bacteria | 49420 |
| 54 | Ga0466728_413832 | 3300042620 | Unclassified | 1923 |
| 55 | Ga0123354_10052133 | 3300010882 | Bacteria | 6167 |
| 56 | Ga0466690_193907 | 3300042590 | Unclassified | 1090 |
| 57 | Ga0466690_334451 | 3300042590 | Bacteria | 2046 |
| 58 | Ga0466691_132757 | 3300042593 | Bacteria | 16814 |
| 59 | Ga0466694_005371 | 3300042594 | Bacteria | 1085 |
| 60 | Ga0466699_301575 | 3300042597 | Bacteria | 8866 |
| 61 | JGI24695J34938_10010130 | 3300002450 | Bacteria | 5191 |
| 62 | JGI24702J35022_10103586 | 3300002462 | Bacteria | 1560 |
| 63 | JGI24702J35022_10601180 | 3300002462 | Bacteria | 680 |
| 64 | Ga0123357_10003185 | 3300009784 | Bacteria | 18677 |
| 65 | Ga0466707_051891 | 3300042601 | Unclassified | 1549 |
| 66 | Ga0466719_192978 | 3300042606 | Bacteria | 28565 |
| 67 | Ga0466719_217708 | 3300042606 | Bacteria | 2966 |
| 68 | Ga0466719_468087 | 3300042606 | Bacteria | 6362 |
| 69 | Ga0466722_065813 | 3300042609 | Bacteria | 20228 |
| 70 | Ga0466735_017427 | 3300042624 | Bacteria | 1013 |
| 71 | Ga0466735_028533 | 3300042624 | Bacteria | 3585 |
| 72 | Ga0466703_072685 | 3300042636 | Bacteria | 15644 |
| 73 | Ga0466703_149371 | 3300042636 | Bacteria | 1468 |
| 74 | Ga0466709_016059 | 3300042648 | Bacteria | 6260 |
| 75 | Ga0466708_083649 | 3300042652 | Unclassified | 1672 |
| 76 | Ga0466715_516035 | 3300042616 | Bacteria | 1449 |
| 77 | Ga0466723_170684 | 3300042618 | Bacteria | 8532 |
| 78 | Ga0466726_326142 | 3300042619 | Bacteria | 1933 |
| 79 | Ga0466726_432621 | 3300042619 | Bacteria | 1288 |
| 80 | Ga0466726_474811 | 3300042619 | Bacteria | 1236 |
| 81 | Ga0466728_128508 | 3300042620 | Bacteria | 10324 |
| 82 | Ga0466690_167632 | 3300042590 | Bacteria | 14358 |
| 83 | Ga0466690_259695 | 3300042590 | Bacteria | 5787 |
| 84 | Ga0466699_212782 | 3300042597 | Bacteria | 1613 |
| 85 | Ga0466699_425281 | 3300042597 | Bacteria | 1237 |
| 86 | Nasutiter_Contig28294 | 2030936001 | Bacteria | 522 |
| 87 | FAAS_10624647 | 3300001880 | Unclassified | 535 |
| 88 | JGI24698J34947_10057318 | 3300002449 | Bacteria | 1933 |
| 89 | JGI24695J34938_10005448 | 3300002450 | Bacteria | 7929 |
| 90 | JGI24695J34938_10115619 | 3300002450 | Bacteria | 1092 |
| 91 | Ga0466707_090696 | 3300042601 | Unclassified | 1600 |
| 92 | Ga0466714_098317 | 3300042603 | Bacteria | 1072 |
| 93 | Ga0466719_494761 | 3300042606 | Unclassified | 2018 |
| 94 | Ga0466703_226676 | 3300042636 | Bacteria | 16226 |
| 95 | Ga0466703_343381 | 3300042636 | Bacteria | 12999 |
| 96 | Ga0466704_167337 | 3300042643 | Bacteria | 117281 |
| 97 | Ga0466704_224103 | 3300042643 | Bacteria | 6416 |
| 98 | Ga0466704_469705 | 3300042643 | Unclassified | 1051 |
| 99 | Ga0466709_081202 | 3300042648 | Bacteria | 7185 |
| 100 | Ga0466709_082658 | 3300042648 | Bacteria | 11609 |
| 101 | Ga0466708_258055 | 3300042652 | Unclassified | 1195 |
| 102 | Ga0466727_326897 | 3300042655 | Bacteria | 1199 |
| 103 | Ga0466711_043114 | 3300042615 | Bacteria | 10077 |
| 104 | Ga0466711_062549 | 3300042615 | Bacteria | 3254 |
| 105 | Ga0466711_484605 | 3300042615 | Bacteria | 2418 |
| 106 | Ga0466715_033116 | 3300042616 | Bacteria | 4597 |
| 107 | Ga0466715_264250 | 3300042616 | Bacteria | 16802 |
| 108 | Ga0466726_202898 | 3300042619 | Bacteria | 4572 |
| 109 | Ga0123356_10228323 | 3300010049 | Bacteria | 1924 |
| 110 | Ga0466690_026109 | 3300042590 | Unclassified | 1117 |
| 111 | Ga0466690_088146 | 3300042590 | Bacteria | 1898 |
| 112 | Ga0466692_022984 | 3300042591 | Bacteria | 6773 |
| 113 | Ga0466693_410886 | 3300042592 | Unclassified | 2536 |
| 114 | Ga0466691_006068 | 3300042593 | Bacteria | 7319 |
| 115 | Ga0466691_138063 | 3300042593 | Bacteria | 3900 |
| 116 | Ga0466696_327345 | 3300042596 | Bacteria | 11315 |
| 117 | Ga0466699_009783 | 3300042597 | Bacteria | 2027 |
| 118 | Ga0466699_149738 | 3300042597 | Bacteria | 9645 |
| 119 | Ga0466699_403371 | 3300042597 | Bacteria | 10189 |
| 120 | JGI24698J34947_10029209 | 3300002449 | Bacteria | 2914 |
| 121 | JGI24695J34938_10021438 | 3300002450 | Bacteria | 3161 |
| 122 | Ga0072941_1047834 | 3300005201 | Bacteria | 7067 |
| 123 | Ga0072941_1254121 | 3300005201 | Bacteria | 723 |
| 124 | Ga0466700_237139 | 3300042600 | Bacteria | 1252 |
| 125 | Ga0466707_082863 | 3300042601 | Unclassified | 1423 |
| 126 | Ga0466707_229996 | 3300042601 | Bacteria | 2051 |
| 127 | Ga0466720_015031 | 3300042607 | Bacteria | 22328 |
| 128 | Ga0466722_051177 | 3300042609 | Bacteria | 4201 |
| 129 | Ga0466722_172875 | 3300042609 | Bacteria | 5464 |
| 130 | Ga0466722_260200 | 3300042609 | Bacteria | 11199 |
| 131 | Ga0466729_306699 | 3300042621 | Unclassified | 1091 |
| 132 | Ga0466709_188526 | 3300042648 | Bacteria | 3815 |
| 133 | Ga0466709_340399 | 3300042648 | Bacteria | 46536 |
| 134 | Ga0466708_193861 | 3300042652 | Bacteria | 11585 |
| 135 | Ga0466708_288804 | 3300042652 | Bacteria | 20693 |
| 136 | Ga0466732_183276 | 3300042656 | Unclassified | 1640 |
| 137 | Ga0466715_050100 | 3300042616 | Unclassified | 1658 |
| 138 | Ga0466715_342230 | 3300042616 | Bacteria | 1455 |
| 139 | Ga0466715_572041 | 3300042616 | Unclassified | 2835 |
| 140 | Ga0466718_150970 | 3300042617 | Unclassified | 13764 |
| 141 | Ga0466726_011978 | 3300042619 | Bacteria | 3096 |
| 142 | Ga0123353_10791612 | 3300010167 | Unclassified | 1311 |
| 143 | Ga0123354_10876851 | 3300010882 | Bacteria | 592 |
| 144 | Ga0456237_0015270 | 3300041968 | Bacteria | 1089 |
| 145 | Ga0466691_052477 | 3300042593 | Bacteria | 6374 |
| 146 | Ga0466691_114031 | 3300042593 | Bacteria | 22683 |
| 147 | Ga0466691_122720 | 3300042593 | Bacteria | 2591 |
| 148 | Ga0466694_129434 | 3300042594 | Bacteria | 2375 |
| 149 | Ga0466696_006728 | 3300042596 | Bacteria | 1175 |
| 150 | Ga0466696_115940 | 3300042596 | Bacteria | 3308 |
| 151 | Ga0466696_344226 | 3300042596 | Bacteria | 42875 |
| 152 | Ga0466699_150332 | 3300042597 | Bacteria | 9436 |
| 153 | JGI24698J34947_10279388 | 3300002449 | Bacteria | 611 |
| 154 | JGI24695J34938_10016275 | 3300002450 | Bacteria | 3788 |
| 155 | JGI24695J34938_10047802 | 3300002450 | Bacteria | 1887 |
| 156 | Ga0466716_053480 | 3300042605 | Bacteria | 4429 |
| 157 | Ga0466698_425754 | 3300042610 | Bacteria | 2309 |
| 158 | Ga0466735_052698 | 3300042624 | Bacteria | 12702 |
| 159 | Ga0466703_049399 | 3300042636 | Bacteria | 26515 |
| 160 | Ga0466703_252384 | 3300042636 | Bacteria | 1309 |
| 161 | Ga0466704_096061 | 3300042643 | Bacteria | 1989 |
| 162 | Ga0466709_055183 | 3300042648 | Bacteria | 6463 |
| 163 | Ga0466709_381435 | 3300042648 | Unclassified | 1896 |
| 164 | Ga0466708_152967 | 3300042652 | Bacteria | 8173 |
| 165 | Ga0466708_373872 | 3300042652 | Bacteria | 4308 |
| 166 | Ga0466705_102014 | 3300042612 | Bacteria | 1223 |
| 167 | Ga0466705_197196 | 3300042612 | Bacteria | 2336 |
| 168 | Ga0466715_050532 | 3300042616 | Bacteria | 20482 |
| 169 | Ga0466715_084371 | 3300042616 | Bacteria | 11174 |
| 170 | Ga0466723_028218 | 3300042618 | Bacteria | 5752 |
| 171 | Ga0466723_061161 | 3300042618 | Bacteria | 56205 |
| 172 | Ga0466723_077603 | 3300042618 | Bacteria | 2360 |
| 173 | Ga0466723_110631 | 3300042618 | Bacteria | 16832 |
| 174 | Ga0466726_220585 | 3300042619 | Unclassified | 2442 |
| 175 | Ga0466726_480744 | 3300042619 | Bacteria | 7676 |
| 176 | Ga0466728_107104 | 3300042620 | Bacteria | 10380 |
| 177 | Ga0466728_144255 | 3300042620 | Bacteria | 5869 |
| 178 | Ga0123356_10187729 | 3300010049 | Bacteria | 2095 |
| 179 | Ga0466690_028547 | 3300042590 | Bacteria | 2806 |
| 180 | Ga0466691_170504 | 3300042593 | Unclassified | 6826 |
| 181 | Ga0466696_119875 | 3300042596 | Bacteria | 16170 |
| 182 | Ga0466699_126917 | 3300042597 | Unclassified | 1494 |
| 183 | AustNasuHG_c1000112 | 3300000089 | Bacteria | 24525 |
| 184 | Ga0072941_1007635 | 3300005201 | Bacteria | 8480 |
| 185 | Ga0466707_312685 | 3300042601 | Bacteria | 1765 |
| 186 | Ga0466716_069057 | 3300042605 | Bacteria | 1297 |
| 187 | Ga0466716_094252 | 3300042605 | Bacteria | 10326 |
| 188 | Ga0466722_114770 | 3300042609 | Bacteria | 67972 |
| 189 | Ga0466709_102520 | 3300042648 | Unclassified | 1571 |
| 190 | Ga0466711_099285 | 3300042615 | Bacteria | 4705 |
| 191 | Ga0466711_448094 | 3300042615 | Bacteria | 12925 |
| 192 | Ga0466718_115478 | 3300042617 | Bacteria | 2634 |
| 193 | Ga0466723_190442 | 3300042618 | Bacteria | 2683 |
| 194 | Ga0466726_022368 | 3300042619 | Bacteria | 5796 |
| 195 | Ga0466726_073728 | 3300042619 | Unclassified | 1540 |
| 196 | Ga0466726_300056 | 3300042619 | Bacteria | 1653 |
| 197 | Ga0466728_042166 | 3300042620 | Bacteria | 1905 |
| 198 | Ga0123355_10030428 | 3300009826 | Bacteria | 8748 |
| 199 | Ga0123354_10093582 | 3300010882 | Bacteria | 4130 |
| 200 | Ga0466691_192923 | 3300042593 | Bacteria | 10205 |
| 201 | Ga0466694_011041 | 3300042594 | Bacteria | 2485 |
| 202 | Ga0466694_336842 | 3300042594 | Bacteria | 2971 |
| 203 | JGI24698J34947_10026197 | 3300002449 | Bacteria | 3100 |
| 204 | Ga0466716_084085 | 3300042605 | Unclassified | 1660 |
| 205 | Ga0466719_063712 | 3300042606 | Bacteria | 26562 |
| 206 | Ga0466719_324845 | 3300042606 | Bacteria | 1341 |
| 207 | Ga0466722_138718 | 3300042609 | Bacteria | 3400 |
| 208 | Ga0466698_023805 | 3300042610 | Bacteria | 3172 |
| 209 | Ga0466735_197192 | 3300042624 | Bacteria | 1095 |
| 210 | Ga0466708_062467 | 3300042652 | Bacteria | 3299 |
| 211 | Ga0466708_129720 | 3300042652 | Bacteria | 4650 |
| 212 | Ga0466708_395761 | 3300042652 | Unclassified | 3147 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00639 | GO:0003755 | peptidyl-prolyl cis-trans isomerase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.