Protein Family IF09936

Metagenome Isolate
149 Members
52 Samples
137 Scaffolds
1153.39 Avg Length

🧬 Representative Sequence

ID
3300042652|Ga0466708_228165|Ga0466708_228165_19468_23154
Length
1228 aa
Sequence
MRLFQKQPLNKNTIRKETVFLRGERMARQSYGVTPWGKWFIDVLDSYRMDARLNRGKTYANTGKVLSLEFNERKAVAKVKGNYRPSYKVEIEFPPLEEQEKAEVLRLIEEDTALVAQIAAGELPESFLQKLKRSGINLIPKRWKDMRRSCNCPDYGDPCKHEAAIYYVIAREIDADPHILFRLRGIDLAVLTAKFGAGLETAVIEPPFSVESGPAERETPALPPEFPAIPHCAGLILSLLAEAPFQSGKDFTVALAEFYHRAARADVWQYTGKDEGRESLFSHSQWTLECAPAHRKQKPKPGADLILVRHGISGETEQYTVYEALSFFRSFSSEKGTLSYTFLYYTAKFLGLLCVSEAFIPSVLLEDGELCIVWQPFKALPAIRGALESLSLFDSGILELESGGKRKKAVYADGRSTVTLLASAMLGEYAKRSYTARRGTGELVQVFFQGTSLDVSSPAVRSLPLAVSKWLSVLHTDFSGGRRTPPVPGVVPVSEAVPVAVTADDASPRKAPGSSPVAGSMAGAAYTYRLLMGAPVQKKGGDAAADREPEFSLAMEVLFEREDATEKAPLKDAAKLTGSIEVLKAPTLLSHYLPELRSLLSRKTVKLAGDRLSDFLDNAAPLLETLGIELVFPKSLRRELKPRLVLQASAKEGAKAGSLVSYLNLNSLLDWQWQVAIGDELISREEFAALLAQKRAVVQFHNTFVRIDPAELSRLLRQTEARAPGLNDFLKYHLSGDSVLAFDAKEIIEKLFNEREYTVPPSLKAELRPYQQRGYNWICSLLYAGFGCILADDMGLGKTVQSIAAMLRLNDDGLLGDGCLIIAPAALLSNWERELARFAPSLRVFRYHGAGRHFADACDVMLTTYQTAARDNAKLVQHTFSLLVVDEAHLMKNAEAKSVKAVKQLRSRFTLALSGTPVENRLEDLRSLFDFVLPGYLGTAAQFKDAYRYPVEVMRNREAAEKLKKITAPFLLRRLKTDKAVISDLPEKIISNEYALLEKGQAALYESVVTEILKKSEQIEEGQGRSALILTLLTSLKQICDHPRVYDKESPALSSLSGKAQLLXXLLEEILTGGEKTLIFSQYVETLDCLEQIIRKEMGEAALCYHGGLSQKNRAAVISRFQNDPASRILLVSLRAGGLGLNLTAASRVIHYDLWYNPAVENQATDRSFRIGQTRNVFVHRFITRNSFEEKIDAMLTAKRELADMTVSSGESWLARMSHEELKTLFDR

📊 Sample Types

Isolate 8.1%
Metagenome 92.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 36.0%
Kalotermitidae 28.0%
Unclassified 26.0%
Termopsidae 6.0%
Rhinotermitidae 4.0%

🌳 Taxonomy

Archaea 0
Bacteria 145
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
8 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
9 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
10 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
11 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
12 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
13 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
14 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
15 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
16 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
17 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
18 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
19 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
20 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
21 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
22 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
23 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
24 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
25 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
26 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
27 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
28 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
29 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
30 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
31 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
32 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
33 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
34 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
35 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
36 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
37 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
39 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
40 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
41 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
42 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
43 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
44 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
45 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
46 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
47 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
48 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
49 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
50 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
51 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
52 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466716_363303 3300042605 Bacteria 4581
2 Ga0466690_110383 3300042590 Bacteria 12698
3 Ga0466692_058889 3300042591 Bacteria 41705
4 Ga0466694_286193 3300042594 Bacteria 3746
5 Ga0466696_352339 3300042596 Bacteria 5923
6 Ga0466699_133344 3300042597 Bacteria 12324
7 Ga0466723_090735 3300042618 Bacteria 19426
8 Ga0466726_158377 3300042619 Bacteria 8665
9 Ga0466726_451350 3300042619 Bacteria 4307
10 JGI24695J34938_10000485 3300002450 Unclassified 38557
11 JGI24695J34938_10000612 3300002450 Bacteria 34215
12 JGI24695J34938_10016056 3300002450 Bacteria 3823
13 Ga0072940_1029207 3300005200 Bacteria 10311
14 Ga0466705_029237 3300042612 Bacteria 16966
15 Ga0466716_000750 3300042605 Bacteria 8585
16 Ga0466716_103555 3300042605 Bacteria 28428
17 Ga0466719_054906 3300042606 Unclassified 20233
18 Ga0466719_114180 3300042606 Bacteria 19353
19 Ga0466720_146325 3300042607 Bacteria 5274
20 Ga0123356_10001263 3300010049 Bacteria 27963
21 Ga0466693_074523 3300042592 Bacteria 6519
22 Ga0466693_118917 3300042592 Bacteria 16184
23 Ga0466691_017652 3300042593 Bacteria 8785
24 Ga0466694_097391 3300042594 Bacteria 28972
25 Ga0466711_107634 3300042615 Bacteria 27645
26 Ga0466711_511149 3300042615 Bacteria 5233
27 Ga0466715_450562 3300042616 Bacteria 17198
28 Ga0466718_006290 3300042617 Bacteria 4418
29 Ga0466726_170186 3300042619 Bacteria 11009
30 JGI24698J34947_10002317 3300002449 Bacteria 10227
31 JGI24698J34947_10004126 3300002449 Bacteria 7878
32 JGI24695J34938_10006420 3300002450 Bacteria 7069
33 JGI24695J34938_10007923 3300002450 Bacteria 6142
34 JGI24695J34938_10008463 3300002450 Bacteria 5862
35 Ga0466709_134433 3300042648 Bacteria 13650
36 Ga0466709_394506 3300042648 Bacteria 15199
37 Ga0466708_275417 3300042652 Bacteria 3876
38 Ga0466727_192939 3300042655 Bacteria 5377
39 Ga0123357_10007863 3300009784 Bacteria 13250
40 Ga0466690_110429 3300042590 Bacteria 63009
41 Ga0466690_414749 3300042590 Bacteria 14351
42 Ga0466691_001806 3300042593 Bacteria 16193
43 Ga0466691_010702 3300042593 Bacteria 18609
44 Ga0466691_216086 3300042593 Bacteria 33762
45 Ga0466694_055111 3300042594 Bacteria 6060
46 Ga0466696_023207 3300042596 Bacteria 24784
47 Ga0466712_211291 3300042614 Bacteria 16887
48 Ga0466712_314711 3300042614 Bacteria 28321
49 Ga0466715_253208 3300042616 Bacteria 4031
50 Ga0466718_024492 3300042617 Bacteria 8459
51 Ga0466723_195288 3300042618 Bacteria 39093
52 Ga0466726_046320 3300042619 Bacteria 3644
53 JGI24698J34947_10000275 3300002449 Bacteria 22092
54 JGI24695J34938_10012039 3300002450 Bacteria 4611
55 Ga0466704_111914 3300042643 Bacteria 32572
56 Ga0466705_150694 3300042612 Bacteria 5764
57 Ga0466713_075514 3300042602 Bacteria 32547
58 Ga0466716_319149 3300042605 Bacteria 14086
59 Ga0466716_366123 3300042605 Bacteria 6597
60 Ga0466720_049778 3300042607 Bacteria 14957
61 Ga0466720_088923 3300042607 Bacteria 14463
62 Ga0466720_146393 3300042607 Unclassified 4444
63 Ga0123356_10000435 3300010049 Bacteria 47721
64 Ga0123356_10000619 3300010049 Bacteria 39296
65 Ga0264413_101923 3300024493 Bacteria 13183
66 Ga0264413_113985 3300024493 Bacteria 28252
67 Ga0466705_397724 3300042612 Bacteria 6860
68 Ga0466712_115862 3300042614 Bacteria 12334
69 Ga0466712_162753 3300042614 Bacteria 24897
70 Ga0466718_038687 3300042617 Bacteria 45428
71 Ga0466723_068107 3300042618 Bacteria 6116
72 Ga0466723_273170 3300042618 Bacteria 8503
73 Ga0466726_222121 3300042619 Bacteria 5418
74 JGI24695J34938_10001263 3300002450 Bacteria 22240
75 JGI24695J34938_10005087 3300002450 Bacteria 8350
76 Ga0072941_1004946 3300005201 Bacteria 12617
77 Ga0466735_090030 3300042624 Bacteria 5418
78 Ga0466703_016621 3300042636 Bacteria 8403
79 Ga0466703_126419 3300042636 Bacteria 30129
80 Ga0466732_047537 3300042656 Bacteria 7187
81 Ga0466720_222971 3300042607 Bacteria 6854
82 Ga0466698_170825 3300042610 Bacteria 29162
83 Ga0466690_031446 3300042590 Unclassified 3891
84 Ga0466691_133046 3300042593 Bacteria 13605
85 Ga0466712_014717 3300042614 Bacteria 3229
86 Ga0466723_131749 3300042618 Bacteria 25706
87 Ga0466726_005380 3300042619 Bacteria 8558
88 Ga0466726_437084 3300042619 Bacteria 13982
89 Ga0466728_217777 3300042620 Bacteria 16071
90 JGI24698J34947_10001060 3300002449 Bacteria 14152
91 JGI24698J34947_10002258 3300002449 Bacteria 10321
92 JGI24695J34938_10002485 3300002450 Bacteria 14065
93 JGI24695J34938_10006175 3300002450 Bacteria 7280
94 Ga0072941_1004016 3300005201 Bacteria 18352
95 Ga0466704_246533 3300042643 Bacteria 11903
96 Ga0466708_064747 3300042652 Bacteria 12481
97 Ga0466720_056326 3300042607 Bacteria 5991
98 Ga0466691_161249 3300042593 Bacteria 15708
99 Ga0466712_010679 3300042614 Bacteria 17309
100 Ga0466711_017224 3300042615 Bacteria 15781
101 Ga0466711_232762 3300042615 Bacteria 31318
102 Ga0466718_006614 3300042617 Bacteria 30223
103 Ga0466718_034112 3300042617 Bacteria 10434
104 AustNasuHG_c1000195 3300000089 Bacteria 20033
105 JGI24698J34947_10005054 3300002449 Bacteria 7226
106 JGI24698J34947_10006212 3300002449 Bacteria 6564
107 JGI24695J34938_10001625 3300002450 Bacteria 18766
108 Ga0072941_1001683 3300005201 Bacteria 28325
109 Ga0466735_107291 3300042624 Bacteria 10116
110 Ga0466703_044868 3300042636 Bacteria 6812
111 Ga0466708_148653 3300042652 Bacteria 7027
112 Ga0466732_025530 3300042656 Bacteria 7962
113 Ga0466719_340314 3300042606 Bacteria 4532
114 Ga0466719_346726 3300042606 Bacteria 4283
115 Ga0123354_10043915 3300010882 Bacteria 6863
116 Ga0456237_0000565 3300041968 Bacteria 5626
117 Ga0466692_109230 3300042591 Bacteria 22637
118 Ga0466693_011165 3300042592 Bacteria 16366
119 Ga0466694_125080 3300042594 Bacteria 16029
120 Ga0466711_165132 3300042615 Bacteria 7161
121 Ga0466715_267195 3300042616 Bacteria 6339
122 Ga0466723_163254 3300042618 Bacteria 7845
123 AustNasuHG_c1006144 3300000089 Bacteria 4293
124 JGI24698J34947_10004094 3300002449 Bacteria 7908
125 JGI24695J34938_10000137 3300002450 Bacteria 66242
126 JGI24702J35022_10005051 3300002462 Bacteria 7774
127 Ga0466704_398818 3300042643 Bacteria 13260
128 Ga0466708_228165 3300042652 Bacteria 31519
129 Ga0466708_257706 3300042652 Bacteria 10209
130 Ga0466719_111220 3300042606 Bacteria 6388
131 Ga0466721_202594 3300042608 Bacteria 33171
132 Ga0123355_10002514 3300009826 Bacteria 25962
133 Ga0264413_100634 3300024493 Bacteria 21808
134 Ga0466692_031254 3300042591 Bacteria 11990
135 Ga0466711_196122 3300042615 Bacteria 16619
136 Ga0466723_025107 3300042618 Bacteria 5360
137 Ga0466703_097389 3300042636 Bacteria 65902

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00176 SNF2-rel_dom SNF2-related domain 770 1044 0.94
PF12419 DUF3670 SNF2 Helicase protein 604 723 0.92
PF00271 Helicase_C Helicase conserved C-terminal domain 1067 1172 0.87
PF04851 ResIII Type III restriction enzyme, res subunit 765 918 0.85
PF00270 DEAD DEAD/DEAH box helicase 781 921 0.77

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.