Protein Family IF09883
Metagenome
Isolate
134
Members
64
Samples
113
Scaffolds
440.04
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_104323|Ga0466708_104323_819_2396
- Length
- 525 aa
- Sequence
- MLFSAKIFFAITAESEGSNPHIVCFSIKLDSQKSAIFFRFTHYSRKDTPTSPCTVWTENGACCFFLAESQTFGYFRSVIHYFCSMIDKTVFENKTAAYYTLGCKLNFAETSAIGRLLSEQGVRRARSGEQADICVVNTCTVTELADKKCRQAIRRISRQHPQAFVVVTGCYAQLKPEEIARIEGVDLVLGAEQKPDILSYLKRLDKAQTSVVATSQTADIRAFAPSCSSDDRTRHFLKVQDGCDYYCSYCTIPFARGRSRNGSIADMLRQAEEVVRRGGKEIVLTGVNIGDFGKSTQETFIDLVRALDEVEGVARYRISSIEPNLITDELIAFVAGSKRFAPHFHIPLQSGSDTVLEWMRRRYDAALFRHKVETIRKWMPDAFIGLDVIVGMRGETDELFEESCAFIRSLDVTRLHVFSYSERPGTQALKIAHTVHPKIRQARSRLLTELSETLQQAFYTRHIGRTANVLFEHTNKGGLMYGFTENYIKVEALCDSATTNEISRVILGGWNRGQTALTCRKPQNP
Sample Types
Isolate
15.7%
Metagenome
84.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
29.7%
Blattidae
20.3%
Kalotermitidae
20.3%
Unclassified
10.9%
Rhinotermitidae
7.8%
Termopsidae
4.7%
Hydrophilidae
3.1%
Tenebrionidae
1.6%
Hodotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
129
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 2 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 3 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 13 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 14 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 15 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 16 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 17 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 18 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 19 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 20 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 21 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 22 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 23 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 24 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 25 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 26 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 27 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 28 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 29 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 30 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 31 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 32 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 33 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 34 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 35 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 36 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 37 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 38 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 39 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 40 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 41 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 42 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 43 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 44 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 45 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 46 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 47 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 48 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 49 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 50 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 51 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 52 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 53 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 54 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 55 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 56 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 57 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 58 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 59 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 60 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 61 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 62 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 63 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 64 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_030958 | 3300042659 | Bacteria | 11257 |
| 2 | Ga0123354_10009055 | 3300010882 | Bacteria | 15196 |
| 3 | Ga0466704_358815 | 3300042643 | Bacteria | 3006 |
| 4 | Ga0466708_104323 | 3300042652 | Bacteria | 9814 |
| 5 | Ga0466725_017415 | 3300042654 | Bacteria | 4329 |
| 6 | Ga0466727_213878 | 3300042655 | Bacteria | 2889 |
| 7 | Ga0466715_436143 | 3300042616 | Bacteria | 5603 |
| 8 | JGI24705J35276_12238610 | 3300002504 | Bacteria | 29496 |
| 9 | Ga0068305_10055846 | 3300005083 | Bacteria | 7407 |
| 10 | Ga0466692_067775 | 3300042591 | Bacteria | 2647 |
| 11 | Ga0466696_227581 | 3300042596 | Bacteria | 20008 |
| 12 | Ga0466706_109799 | 3300042599 | Bacteria | 205088 |
| 13 | Ga0466707_245151 | 3300042601 | Bacteria | 10924 |
| 14 | Ga0466707_306665 | 3300042601 | Bacteria | 13988 |
| 15 | Ga0466716_445964 | 3300042605 | Bacteria | 2581 |
| 16 | Ga0123357_10061575 | 3300009784 | Bacteria | 5029 |
| 17 | Ga0466703_049206 | 3300042636 | Bacteria | 9106 |
| 18 | Ga0466703_121692 | 3300042636 | Bacteria | 11097 |
| 19 | Ga0466703_300804 | 3300042636 | Bacteria | 10589 |
| 20 | Ga0466703_316098 | 3300042636 | Bacteria | 40247 |
| 21 | Ga0466704_276568 | 3300042643 | Bacteria | 7871 |
| 22 | Ga0466710_041581 | 3300042613 | Bacteria | 3372 |
| 23 | Ga0466711_498387 | 3300042615 | Bacteria | 4455 |
| 24 | Ga0466726_364953 | 3300042619 | Unclassified | 3306 |
| 25 | JGI24699J35502_11134229 | 3300002509 | Bacteria | 98606 |
| 26 | Ga0466696_035891 | 3300042596 | Bacteria | 6230 |
| 27 | Ga0466696_057503 | 3300042596 | Bacteria | 1676 |
| 28 | Ga0466696_257729 | 3300042596 | Bacteria | 16447 |
| 29 | Ga0466707_086626 | 3300042601 | Bacteria | 4252 |
| 30 | Ga0466713_071698 | 3300042602 | Unclassified | 13103 |
| 31 | Ga0466697_056567 | 3300042611 | Bacteria | 485126 |
| 32 | Ga0123354_10009678 | 3300010882 | Bacteria | 14794 |
| 33 | Ga0123354_10066300 | 3300010882 | Bacteria | 5274 |
| 34 | Ga0466735_174720 | 3300042624 | Bacteria | 53942 |
| 35 | Ga0466703_360158 | 3300042636 | Bacteria | 2544 |
| 36 | Ga0466704_108007 | 3300042643 | Bacteria | 33144 |
| 37 | Ga0466704_375503 | 3300042643 | Bacteria | 7980 |
| 38 | Ga0466708_335498 | 3300042652 | Bacteria | 5444 |
| 39 | Ga0466727_161361 | 3300042655 | Bacteria | 6277 |
| 40 | Ga0466727_297230 | 3300042655 | Bacteria | 9787 |
| 41 | Ga0466715_482629 | 3300042616 | Bacteria | 44538 |
| 42 | Ga0466728_198023 | 3300042620 | Bacteria | 9140 |
| 43 | JGI24702J35022_10002240 | 3300002462 | Bacteria | 11889 |
| 44 | Ga0466656_249630 | 3300042550 | Bacteria | 15804 |
| 45 | Ga0466690_276695 | 3300042590 | Bacteria | 6682 |
| 46 | Ga0466706_045681 | 3300042599 | Bacteria | 6080 |
| 47 | Ga0466716_112024 | 3300042605 | Bacteria | 6542 |
| 48 | Ga0466719_003919 | 3300042606 | Bacteria | 5837 |
| 49 | Ga0466722_110606 | 3300042609 | Bacteria | 4435 |
| 50 | Ga0466733_044535 | 3300042659 | Bacteria | 127501 |
| 51 | Ga0466703_036485 | 3300042636 | Bacteria | 3488 |
| 52 | Ga0466725_243294 | 3300042654 | Bacteria | 41653 |
| 53 | Ga0466710_067573 | 3300042613 | Bacteria | 9596 |
| 54 | Ga0466711_007863 | 3300042615 | Bacteria | 3497 |
| 55 | Ga0072940_1041538 | 3300005200 | Bacteria | 1409 |
| 56 | Ga0466696_191206 | 3300042596 | Bacteria | 7517 |
| 57 | Ga0466713_032907 | 3300042602 | Bacteria | 3405 |
| 58 | Ga0466713_051288 | 3300042602 | Bacteria | 230715 |
| 59 | Ga0466713_151594 | 3300042602 | Bacteria | 8381 |
| 60 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 61 | Ga0123357_10061966 | 3300009784 | Bacteria | 5010 |
| 62 | Ga0123353_10202758 | 3300010167 | Bacteria | 3119 |
| 63 | Ga0466729_243295 | 3300042621 | Bacteria | 3251 |
| 64 | Ga0466734_063528 | 3300042623 | Bacteria | 2916 |
| 65 | Ga0466735_062073 | 3300042624 | Bacteria | 1970 |
| 66 | Ga0466713_071505 | 3300042602 | Bacteria | 34437 |
| 67 | Ga0466713_110965 | 3300042602 | Bacteria | 66281 |
| 68 | Ga0466719_001353 | 3300042606 | Bacteria | 19992 |
| 69 | Ga0466697_131617 | 3300042611 | Bacteria | 2441 |
| 70 | Ga0466733_027595 | 3300042659 | Bacteria | 96004 |
| 71 | Ga0123356_10241912 | 3300010049 | Bacteria | 1876 |
| 72 | Ga0466730_067784 | 3300042625 | Unclassified | 3635 |
| 73 | Ga0466709_356549 | 3300042648 | Bacteria | 2397 |
| 74 | Ga0466711_301932 | 3300042615 | Bacteria | 4874 |
| 75 | Ga0466715_491159 | 3300042616 | Bacteria | 21907 |
| 76 | Ga0466723_065182 | 3300042618 | Bacteria | 22399 |
| 77 | Ga0466726_191446 | 3300042619 | Bacteria | 5808 |
| 78 | Ga0466728_081913 | 3300042620 | Bacteria | 13089 |
| 79 | Ga0466690_072932 | 3300042590 | Bacteria | 6653 |
| 80 | Ga0466690_094693 | 3300042590 | Bacteria | 13567 |
| 81 | Ga0466707_006778 | 3300042601 | Unclassified | 8442 |
| 82 | Ga0466707_061625 | 3300042601 | Bacteria | 2758 |
| 83 | Ga0466707_075813 | 3300042601 | Bacteria | 48180 |
| 84 | Ga0466707_261779 | 3300042601 | Bacteria | 1883 |
| 85 | Ga0466713_020927 | 3300042602 | Bacteria | 10228 |
| 86 | Ga0466713_022290 | 3300042602 | Bacteria | 44306 |
| 87 | Ga0466722_024325 | 3300042609 | Bacteria | 3940 |
| 88 | Ga0123354_10001662 | 3300010882 | Bacteria | 27721 |
| 89 | Ga0466703_054864 | 3300042636 | Bacteria | 5052 |
| 90 | Ga0466708_098972 | 3300042652 | Bacteria | 17381 |
| 91 | Ga0466715_501049 | 3300042616 | Bacteria | 14178 |
| 92 | Ga0466728_380545 | 3300042620 | Bacteria | 7706 |
| 93 | Ga0068305_10213567 | 3300005083 | Bacteria | 4924 |
| 94 | Ga0466657_048162 | 3300042582 | Bacteria | 1645 |
| 95 | Ga0466690_013833 | 3300042590 | Bacteria | 20392 |
| 96 | Ga0466692_173188 | 3300042591 | Bacteria | 49928 |
| 97 | Ga0466716_461245 | 3300042605 | Bacteria | 12296 |
| 98 | Ga0466722_007264 | 3300042609 | Bacteria | 3601 |
| 99 | Ga0466705_207510 | 3300042612 | Bacteria | 9037 |
| 100 | Ga0466705_336702 | 3300042612 | Bacteria | 3008 |
| 101 | Ga0466733_087294 | 3300042659 | Bacteria | 1987 |
| 102 | Ga0466731_376067 | 3300042622 | Bacteria | 2098 |
| 103 | Ga0466703_221606 | 3300042636 | Bacteria | 14191 |
| 104 | Ga0466703_317921 | 3300042636 | Bacteria | 14535 |
| 105 | Ga0466709_063954 | 3300042648 | Bacteria | 7154 |
| 106 | Ga0466727_072163 | 3300042655 | Bacteria | 22770 |
| 107 | Ga0466712_189950 | 3300042614 | Unclassified | 1993 |
| 108 | Ga0466711_007063 | 3300042615 | Bacteria | 43478 |
| 109 | Ga0466715_098106 | 3300042616 | Bacteria | 4286 |
| 110 | Ga0466723_208822 | 3300042618 | Bacteria | 6293 |
| 111 | JGI24699J35502_11134030 | 3300002509 | Bacteria | 25274 |
| 112 | Ga0466690_002509 | 3300042590 | Bacteria | 12036 |
| 113 | Ga0466700_067820 | 3300042600 | Bacteria | 5349 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.