Protein Family IF09850
Metagenome
Isolate
116
Members
40
Samples
105
Scaffolds
280.28
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_052688|Ga0466708_052688_2424_3284
- Length
- 277 aa
- Sequence
- MTVAEITWTVDPAIFSVGSREIRWYALAFIVKRMWIREEIPPAWLEPLLYYTVAGTVIGARLGHCLFYSPDYYLANPVEILKMWEGGLASHGGVLGIMVAIWFYSRNVSHQNMLWTFDKLVVPTGLVAALIRLGNLMNHEIYGHPTDLPWGFRFIENLHAWRQEGAEPLFSAPSHPTQIYEALCYLFTFALCMWLYFRKDAWKRQGFIFGLFLICIFTARFLIEFLKNDQEAFEAGMALNMGQWLSIPFILAGLFFVRRAFKRQPVTYSYRNAKDRK
Sample Types
Isolate
9.5%
Metagenome
90.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
32.5%
Termitidae
20.0%
Blattidae
17.5%
Unclassified
10.0%
Termopsidae
7.5%
Rhinotermitidae
7.5%
Passalidae
5.0%
Taxonomy
Archaea
0
Bacteria
111
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 3 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 4 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 5 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 6 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 7 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 16 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 21 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 22 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 25 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 26 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 27 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 28 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 29 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 30 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 31 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 34 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 35 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 36 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 37 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 38 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 39 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 40 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_038286 | 3300042659 | Bacteria | 266317 |
| 2 | Ga0466718_123052 | 3300042617 | Bacteria | 1697 |
| 3 | Ga0466726_222610 | 3300042619 | Bacteria | 7867 |
| 4 | Ga0466696_185558 | 3300042596 | Bacteria | 17647 |
| 5 | 2227316903 | 2225789004 | Bacteria | 6452 |
| 6 | JGI24702J35022_10000138 | 3300002462 | Bacteria | 36376 |
| 7 | JGI24702J35022_10013176 | 3300002462 | Bacteria | 4583 |
| 8 | JGI24702J35022_10041059 | 3300002462 | Bacteria | 2466 |
| 9 | Ga0466722_061096 | 3300042609 | Unclassified | 12742 |
| 10 | Ga0466722_111472 | 3300042609 | Bacteria | 10577 |
| 11 | Ga0466703_110585 | 3300042636 | Bacteria | 5800 |
| 12 | Ga0466733_064013 | 3300042659 | Bacteria | 2853 |
| 13 | Ga0466711_009554 | 3300042615 | Bacteria | 1618 |
| 14 | Ga0466711_187959 | 3300042615 | Unclassified | 2175 |
| 15 | Ga0466656_154814 | 3300042550 | Bacteria | 10154 |
| 16 | Ga0466690_041120 | 3300042590 | Bacteria | 21497 |
| 17 | Ga0068305_10050200 | 3300005083 | Bacteria | 7119 |
| 18 | Ga0466700_124909 | 3300042600 | Bacteria | 3119 |
| 19 | Ga0466719_214653 | 3300042606 | Bacteria | 6113 |
| 20 | Ga0466722_160383 | 3300042609 | Bacteria | 27402 |
| 21 | Ga0466704_044022 | 3300042643 | Bacteria | 23517 |
| 22 | Ga0466733_004812 | 3300042659 | Bacteria | 14623 |
| 23 | Ga0466705_399550 | 3300042612 | Bacteria | 30994 |
| 24 | Ga0466705_438199 | 3300042612 | Bacteria | 17804 |
| 25 | Ga0466723_025054 | 3300042618 | Bacteria | 2122 |
| 26 | Ga0466723_354948 | 3300042618 | Bacteria | 23912 |
| 27 | Ga0466728_154188 | 3300042620 | Bacteria | 1312 |
| 28 | Ga0466690_069743 | 3300042590 | Bacteria | 14040 |
| 29 | Ga0466690_269418 | 3300042590 | Bacteria | 5069 |
| 30 | JGI24702J35022_10000967 | 3300002462 | Bacteria | 17950 |
| 31 | JGI24702J35022_10033941 | 3300002462 | Bacteria | 2729 |
| 32 | Ga0068302_10238004 | 3300005071 | Bacteria | 1446 |
| 33 | Ga0466713_013575 | 3300042602 | Bacteria | 6289 |
| 34 | Ga0466716_000217 | 3300042605 | Bacteria | 7743 |
| 35 | Ga0466719_086420 | 3300042606 | Bacteria | 1137 |
| 36 | Ga0466719_287400 | 3300042606 | Bacteria | 6117 |
| 37 | Ga0466722_185059 | 3300042609 | Bacteria | 11746 |
| 38 | Ga0466704_163866 | 3300042643 | Bacteria | 3327 |
| 39 | Ga0466704_235028 | 3300042643 | Bacteria | 7683 |
| 40 | Ga0466708_029387 | 3300042652 | Bacteria | 22724 |
| 41 | Ga0466708_434006 | 3300042652 | Bacteria | 8063 |
| 42 | Ga0466705_102679 | 3300042612 | Bacteria | 3075 |
| 43 | Ga0466705_497131 | 3300042612 | Bacteria | 27603 |
| 44 | Ga0466715_400041 | 3300042616 | Bacteria | 26123 |
| 45 | Ga0466723_301081 | 3300042618 | Bacteria | 11213 |
| 46 | Ga0466723_363366 | 3300042618 | Bacteria | 19501 |
| 47 | Ga0466690_398515 | 3300042590 | Bacteria | 1765 |
| 48 | Ga0466696_038246 | 3300042596 | Bacteria | 19371 |
| 49 | Ga0466696_057822 | 3300042596 | Bacteria | 24547 |
| 50 | Ga0466701_077922 | 3300042598 | Bacteria | 7465 |
| 51 | Ga0466713_010624 | 3300042602 | Bacteria | 12241 |
| 52 | Ga0466703_209026 | 3300042636 | Bacteria | 32874 |
| 53 | Ga0466704_090993 | 3300042643 | Bacteria | 11106 |
| 54 | Ga0466704_485734 | 3300042643 | Bacteria | 6162 |
| 55 | Ga0466704_582225 | 3300042643 | Bacteria | 53049 |
| 56 | Ga0466705_442429 | 3300042612 | Bacteria | 11113 |
| 57 | Ga0466712_160184 | 3300042614 | Unclassified | 2553 |
| 58 | Ga0466711_064702 | 3300042615 | Bacteria | 28145 |
| 59 | Ga0466715_107883 | 3300042616 | Bacteria | 15928 |
| 60 | Ga0466718_074787 | 3300042617 | Bacteria | 2215 |
| 61 | JGI24702J35022_10007018 | 3300002462 | Bacteria | 6468 |
| 62 | Ga0466716_222358 | 3300042605 | Bacteria | 9643 |
| 63 | Ga0466703_177366 | 3300042636 | Unclassified | 8461 |
| 64 | Ga0466703_250877 | 3300042636 | Bacteria | 4114 |
| 65 | Ga0466727_029179 | 3300042655 | Bacteria | 5049 |
| 66 | Ga0466715_185934 | 3300042616 | Bacteria | 13383 |
| 67 | Ga0466715_508101 | 3300042616 | Bacteria | 17805 |
| 68 | Ga0466726_441370 | 3300042619 | Bacteria | 6952 |
| 69 | Ga0466728_167204 | 3300042620 | Bacteria | 7125 |
| 70 | Ga0466728_277157 | 3300042620 | Bacteria | 1627 |
| 71 | Ga0466690_154142 | 3300042590 | Bacteria | 2956 |
| 72 | Ga0466690_333013 | 3300042590 | Bacteria | 1972 |
| 73 | Ga0466696_001911 | 3300042596 | Bacteria | 82336 |
| 74 | Ga0123356_10008309 | 3300010049 | Bacteria | 10330 |
| 75 | IMNBL1DRAFT_c0000936 | 3300000062 | Bacteria | 22561 |
| 76 | Ga0466719_162727 | 3300042606 | Bacteria | 34676 |
| 77 | Ga0466733_213148 | 3300042659 | Bacteria | 45617 |
| 78 | Ga0466711_033795 | 3300042615 | Bacteria | 5505 |
| 79 | Ga0466711_212398 | 3300042615 | Bacteria | 10673 |
| 80 | Ga0466711_272178 | 3300042615 | Bacteria | 1647 |
| 81 | Ga0466690_389876 | 3300042590 | Unclassified | 1496 |
| 82 | Ga0466691_048639 | 3300042593 | Bacteria | 38512 |
| 83 | Ga0466716_528684 | 3300042605 | Bacteria | 22222 |
| 84 | Ga0466722_048373 | 3300042609 | Bacteria | 17703 |
| 85 | Ga0466703_197916 | 3300042636 | Bacteria | 14155 |
| 86 | Ga0466708_052688 | 3300042652 | Bacteria | 18489 |
| 87 | Ga0466727_071200 | 3300042655 | Bacteria | 9346 |
| 88 | Ga0466727_169105 | 3300042655 | Bacteria | 7986 |
| 89 | Ga0466705_013387 | 3300042612 | Bacteria | 2709 |
| 90 | Ga0466733_062564 | 3300042659 | Bacteria | 17813 |
| 91 | Ga0466711_271474 | 3300042615 | Bacteria | 4229 |
| 92 | Ga0466715_074850 | 3300042616 | Bacteria | 4550 |
| 93 | Ga0466726_367695 | 3300042619 | Bacteria | 5656 |
| 94 | Ga0466729_082744 | 3300042621 | Bacteria | 9963 |
| 95 | Ga0466692_193814 | 3300042591 | Bacteria | 23056 |
| 96 | Ga0466691_146667 | 3300042593 | Bacteria | 8924 |
| 97 | 2227308568 | 2225789004 | Bacteria | 6550 |
| 98 | JGI24702J35022_10112068 | 3300002462 | Bacteria | 1500 |
| 99 | Ga0068302_10322407 | 3300005071 | Bacteria | 1039 |
| 100 | Ga0466707_091828 | 3300042601 | Bacteria | 1923 |
| 101 | Ga0466707_332842 | 3300042601 | Bacteria | 12251 |
| 102 | Ga0466713_093483 | 3300042602 | Bacteria | 2289 |
| 103 | Ga0466722_046557 | 3300042609 | Bacteria | 3426 |
| 104 | Ga0466703_115474 | 3300042636 | Bacteria | 9589 |
| 105 | Ga0466727_157269 | 3300042655 | Bacteria | 5248 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01790 | LGT | Prolipoprotein diacylglyceryl transferase | 12 | 257 | 0.85 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.