Protein Family IF09832
Metagenome
Isolate
116
Members
34
Samples
114
Scaffolds
230.04
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_027958|Ga0466708_027958_7581_8312
- Length
- 243 aa
- Sequence
- VTASGKGIAFMLQMTGFMLEGAFTSLRVFFLTLLFSVPLALPVAFGRMSKNPPVRAIVNFYLLVMRGTPLILQLIFIYFAPKYFYAFLHNNFSALIVSGAFWDGARAVLSYNRFTAVIIAFSLNYAAYFAEIYRGGIESIPGGQYEAAKVLGFTRSGTFLRIILPQVVKRILPASGNEVITLVKDTALAQVIGVAELFHAAQNAAAREFSTMPIFVAGLFYLVMNWMVTAAFARVEKKLSYYS
Sample Types
Isolate
1.7%
Metagenome
98.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
39.4%
Termitidae
36.4%
Rhinotermitidae
9.1%
Unclassified
6.1%
Termopsidae
6.1%
Hodotermitidae
3.0%
Taxonomy
Archaea
0
Bacteria
107
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 2 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 3 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 4 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 5 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 8 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 9 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 10 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 15 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 16 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 17 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 18 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 19 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 20 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 23 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 24 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 25 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 26 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 27 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 28 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 29 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 30 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 31 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 32 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 33 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 34 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123353_10916760 | 3300010167 | Bacteria | 1190 |
| 2 | Ga0123354_10365783 | 3300010882 | Bacteria | 1265 |
| 3 | Ga0466691_040043 | 3300042593 | Bacteria | 2163 |
| 4 | Ga0466694_266931 | 3300042594 | Unclassified | 2249 |
| 5 | Ga0466694_336652 | 3300042594 | Bacteria | 8120 |
| 6 | Ga0466696_205482 | 3300042596 | Bacteria | 15324 |
| 7 | Ga0466715_615105 | 3300042616 | Bacteria | 2311 |
| 8 | Ga0466723_159001 | 3300042618 | Bacteria | 43446 |
| 9 | Ga0466728_481748 | 3300042620 | Bacteria | 2151 |
| 10 | Ga0466719_422105 | 3300042606 | Bacteria | 4432 |
| 11 | Ga0466704_124476 | 3300042643 | Bacteria | 1059 |
| 12 | Ga0466708_027958 | 3300042652 | Bacteria | 12389 |
| 13 | Ga0466727_166112 | 3300042655 | Bacteria | 1253 |
| 14 | Ga0123357_10051382 | 3300009784 | Bacteria | 5572 |
| 15 | Ga0123357_10164420 | 3300009784 | Bacteria | 2648 |
| 16 | Ga0123356_10694116 | 3300010049 | Unclassified | 1187 |
| 17 | Ga0123353_10445254 | 3300010167 | Bacteria | 1909 |
| 18 | Ga0466692_010852 | 3300042591 | Unclassified | 3178 |
| 19 | Ga0466694_172031 | 3300042594 | Bacteria | 1166 |
| 20 | Ga0466726_279513 | 3300042619 | Bacteria | 3945 |
| 21 | Ga0466716_014951 | 3300042605 | Bacteria | 2929 |
| 22 | Ga0466716_328779 | 3300042605 | Bacteria | 17729 |
| 23 | Ga0466722_267288 | 3300042609 | Bacteria | 4603 |
| 24 | JGI24702J35022_10019686 | 3300002462 | Bacteria | 3671 |
| 25 | Ga0072941_1004526 | 3300005201 | Bacteria | 12514 |
| 26 | Ga0466704_275324 | 3300042643 | Bacteria | 11087 |
| 27 | Ga0466709_191447 | 3300042648 | Bacteria | 8596 |
| 28 | Ga0466705_245609 | 3300042612 | Bacteria | 3099 |
| 29 | Ga0123357_10473221 | 3300009784 | Bacteria | 1066 |
| 30 | Ga0456237_0005130 | 3300041968 | Bacteria | 2084 |
| 31 | Ga0466692_039354 | 3300042591 | Bacteria | 1561 |
| 32 | Ga0466691_175191 | 3300042593 | Bacteria | 7694 |
| 33 | Ga0466694_094664 | 3300042594 | Bacteria | 6479 |
| 34 | Ga0466699_084155 | 3300042597 | Bacteria | 1195 |
| 35 | Ga0466719_119934 | 3300042606 | Bacteria | 1124 |
| 36 | Ga0466722_095242 | 3300042609 | Bacteria | 1069 |
| 37 | Ga0466722_236386 | 3300042609 | Bacteria | 1919 |
| 38 | Ga0466703_113296 | 3300042636 | Bacteria | 4956 |
| 39 | Ga0466704_291003 | 3300042643 | Bacteria | 20080 |
| 40 | Ga0466709_013124 | 3300042648 | Unclassified | 5130 |
| 41 | Ga0123353_10261347 | 3300010167 | Bacteria | 2673 |
| 42 | Ga0123353_10318188 | 3300010167 | Bacteria | 2363 |
| 43 | Ga0466690_063465 | 3300042590 | Bacteria | 4247 |
| 44 | Ga0466691_010342 | 3300042593 | Bacteria | 18793 |
| 45 | Ga0466691_045548 | 3300042593 | Bacteria | 2733 |
| 46 | Ga0466696_299704 | 3300042596 | Bacteria | 6074 |
| 47 | Ga0466715_177600 | 3300042616 | Bacteria | 1225 |
| 48 | Ga0466715_453261 | 3300042616 | Bacteria | 2760 |
| 49 | Ga0466723_182976 | 3300042618 | Unclassified | 3373 |
| 50 | Ga0466726_260359 | 3300042619 | Bacteria | 2463 |
| 51 | Ga0466726_267515 | 3300042619 | Bacteria | 2087 |
| 52 | Ga0466703_362677 | 3300042636 | Unclassified | 9561 |
| 53 | Ga0466709_417269 | 3300042648 | Bacteria | 6862 |
| 54 | Ga0466708_436649 | 3300042652 | Bacteria | 1974 |
| 55 | Ga0466727_019171 | 3300042655 | Bacteria | 2405 |
| 56 | Ga0123353_10285418 | 3300010167 | Bacteria | 2531 |
| 57 | Ga0466692_073514 | 3300042591 | Bacteria | 12002 |
| 58 | Ga0466692_085945 | 3300042591 | Bacteria | 6285 |
| 59 | Ga0466696_273379 | 3300042596 | Unclassified | 2603 |
| 60 | Ga0466696_323292 | 3300042596 | Bacteria | 1162 |
| 61 | Ga0466715_240439 | 3300042616 | Bacteria | 8619 |
| 62 | Ga0466715_383132 | 3300042616 | Unclassified | 2937 |
| 63 | Ga0466723_003343 | 3300042618 | Bacteria | 5529 |
| 64 | Ga0466728_251956 | 3300042620 | Bacteria | 2285 |
| 65 | Ga0466701_028119 | 3300042598 | Bacteria | 1127 |
| 66 | Ga0466719_049120 | 3300042606 | Bacteria | 3106 |
| 67 | Ga0466719_371145 | 3300042606 | Bacteria | 4094 |
| 68 | Ga0466722_139518 | 3300042609 | Bacteria | 2835 |
| 69 | JGI24698J34947_10000331 | 3300002449 | Bacteria | 20915 |
| 70 | Ga0466709_001185 | 3300042648 | Bacteria | 1423 |
| 71 | Ga0466708_201392 | 3300042652 | Bacteria | 9634 |
| 72 | Ga0466708_233463 | 3300042652 | Bacteria | 3427 |
| 73 | Ga0466708_299459 | 3300042652 | Bacteria | 6691 |
| 74 | Ga0456237_0004167 | 3300041968 | Bacteria | 2328 |
| 75 | Ga0466692_001160 | 3300042591 | Bacteria | 2297 |
| 76 | Ga0466694_079822 | 3300042594 | Bacteria | 1554 |
| 77 | Ga0466696_393547 | 3300042596 | Bacteria | 1918 |
| 78 | Ga0466712_204614 | 3300042614 | Bacteria | 1459 |
| 79 | Ga0466712_299006 | 3300042614 | Unclassified | 1300 |
| 80 | Ga0466715_049697 | 3300042616 | Bacteria | 16425 |
| 81 | Ga0466715_283949 | 3300042616 | Bacteria | 3353 |
| 82 | Ga0466706_182594 | 3300042599 | Bacteria | 1666 |
| 83 | Ga0466714_089873 | 3300042603 | Bacteria | 1118 |
| 84 | Ga0466722_078186 | 3300042609 | Bacteria | 4595 |
| 85 | Ga0466708_030509 | 3300042652 | Bacteria | 4461 |
| 86 | Ga0466690_016388 | 3300042590 | Bacteria | 4727 |
| 87 | Ga0466690_403980 | 3300042590 | Bacteria | 18990 |
| 88 | Ga0466696_243649 | 3300042596 | Bacteria | 16252 |
| 89 | Ga0466712_045873 | 3300042614 | Bacteria | 2774 |
| 90 | Ga0466715_114300 | 3300042616 | Bacteria | 1206 |
| 91 | Ga0466723_031358 | 3300042618 | Bacteria | 23219 |
| 92 | Ga0466723_190368 | 3300042618 | Bacteria | 4204 |
| 93 | Ga0466726_341514 | 3300042619 | Bacteria | 1157 |
| 94 | Ga0466728_005545 | 3300042620 | Bacteria | 3035 |
| 95 | Ga0466716_133127 | 3300042605 | Bacteria | 2098 |
| 96 | Ga0466716_426069 | 3300042605 | Bacteria | 2025 |
| 97 | Ga0466719_186590 | 3300042606 | Bacteria | 2314 |
| 98 | Ga0466719_410277 | 3300042606 | Bacteria | 2724 |
| 99 | Ga0466719_536845 | 3300042606 | Bacteria | 2018 |
| 100 | JGI24702J35022_10000858 | 3300002462 | Bacteria | 18804 |
| 101 | Ga0072941_1015278 | 3300005201 | Bacteria | 7926 |
| 102 | Ga0466703_310515 | 3300042636 | Bacteria | 11029 |
| 103 | Ga0466708_043622 | 3300042652 | Bacteria | 12780 |
| 104 | Ga0123357_10098401 | 3300009784 | Bacteria | 3781 |
| 105 | Ga0123356_10387679 | 3300010049 | Bacteria | 1531 |
| 106 | Ga0123353_10018984 | 3300010167 | Bacteria | 10199 |
| 107 | Ga0466690_120542 | 3300042590 | Bacteria | 2670 |
| 108 | Ga0466694_236336 | 3300042594 | Bacteria | 2234 |
| 109 | Ga0466705_410975 | 3300042612 | Bacteria | 2644 |
| 110 | Ga0466712_311051 | 3300042614 | Bacteria | 3657 |
| 111 | Ga0466716_286341 | 3300042605 | Bacteria | 3655 |
| 112 | Ga0466716_362855 | 3300042605 | Bacteria | 2492 |
| 113 | Ga0466698_363026 | 3300042610 | Bacteria | 1305 |
| 114 | Ga0466708_065466 | 3300042652 | Bacteria | 4617 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component | 37 | 240 | 0.93 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.