Protein Family IF09731
Metagenome
Metatranscriptome
Isolate
259
Members
104
Samples
216
Scaffolds
216.1
Avg Length
Representative Sequence
- ID
- 3300042649|Ga0466724_23296|Ga0466724_23296_1943_2599
- Length
- 218 aa
- Sequence
- MKNDQLRASVLSVKLIANVNPDMAKEFELKPEHKSIGVITVDSDDVTYTALDEATKAADVEVVYARSFYGGAANANTKLAGEVIGILAGPSPAEVRSGLNAAVDFIESGVATFYSANEDDSIVYYAQPISRTGSYLSKTAGVREGEAIAYLIAPPLEAMYALDAAMKAAAVELKAFFGPPSETNFGGGLLTGSQSAVKAACDAFADAVKFVADNPTDY
Sample Types
Isolate
16.6%
Metagenome
82.6%
MAG
0.0%
Metatranscriptome
0.8%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
30.9%
Unclassified
20.6%
Kalotermitidae
14.4%
Apidae
6.2%
Rhinotermitidae
4.1%
Tenebrionidae
4.1%
Drosophilidae
3.1%
Termopsidae
3.1%
Blattidae
2.1%
Formicidae
2.1%
Armadillidiidae
1.0%
Elmidae
1.0%
Calliphoridae
1.0%
Bombycidae
1.0%
Hodotermitidae
1.0%
Scarabaeidae
1.0%
Libellulidae
1.0%
Hydrophilidae
1.0%
Plutellidae
1.0%
Taxonomy
Archaea
0
Bacteria
218
Eukaryota
0
Viruses
0
Unclassified
41
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300005313 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 2 gut | Metagenome | Drosophilidae |
| 4 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 5 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 6 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 7 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 8 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 9 | 641736255 | Paenibacillus larvae larvae BRL-230010 | Isolate | Unclassified |
| 10 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 11 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 12 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 13 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 14 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 15 | 2820899690 | Unclassified Actinobacteria Emb289P4bin9 | Isolate | Unclassified |
| 16 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 17 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 18 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 19 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 20 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 21 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 22 | 8108568626 | Enterococcus sp. DIV1094 | Isolate | |
| 23 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 24 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 25 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 26 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 27 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 28 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 29 | 2836667214 | Paenibacillus larvae larvae B-3650 | Isolate | Apidae |
| 30 | 2849099867 | Paenibacillus larvae larvae ERIC_I | Isolate | Unclassified |
| 31 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 32 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 33 | 2820424542 | Unclassified Firmicutes Lab288P3bin47 | Isolate | Unclassified |
| 34 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 35 | 2820901319 | Unclassified Actinobacteria Emb289P4bin58 | Isolate | Unclassified |
| 36 | 2820944107 | Unclassified Actinobacteria Cu122P5bin14 | Isolate | Unclassified |
| 37 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 38 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 39 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 40 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 41 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 42 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 43 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 44 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 45 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 46 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 47 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 48 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 49 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 50 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 51 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 52 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 53 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 54 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 55 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 56 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 57 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 58 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 59 | 2523231078 | Paenibacillus larvae larvae 4-309, DSM 25430 | Isolate | Apidae |
| 60 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 61 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 62 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 63 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 64 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 65 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 66 | 646311952 | Sebaldella termitidis ATCC 33386 | Isolate | Unclassified |
| 67 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 68 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 69 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 70 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 71 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 72 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 73 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 74 | 2850744690 | Paenibacillus larvae larvae DSM 25430 | Isolate | Apidae |
| 75 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 76 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 77 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 78 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 79 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 80 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 81 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 82 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 83 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 84 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 85 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 86 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 87 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 88 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 89 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 90 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 91 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 92 | 2834951433 | Brochothrix thermosphacta CD 337 | Isolate | Unclassified |
| 93 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 94 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 95 | 2820838073 | Unclassified Actinobacteria Lab288P4bin27 | Isolate | Unclassified |
| 96 | 2820007728 | Unclassified Synergistetes Lab288P3bin114 | Isolate | Unclassified |
| 97 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 98 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 99 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 100 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 101 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 102 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 103 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 104 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_335356 | 3300042612 | Bacteria | 7475 |
| 2 | Ga0562379_0011 | 3300056790 | Bacteria | 1623141 |
| 3 | Ga0562375_0126 | 3300056856 | Bacteria | 230981 |
| 4 | JGI24698J34947_10054669 | 3300002449 | Bacteria | 1992 |
| 5 | Ga0068302_10332654 | 3300005071 | Unclassified | 2171 |
| 6 | Ga0072940_1030787 | 3300005200 | Bacteria | 2829 |
| 7 | Ga0123357_10000273 | 3300009784 | Bacteria | 49322 |
| 8 | Ga0123357_10150967 | 3300009784 | Bacteria | 2819 |
| 9 | Ga0123355_10150143 | 3300009826 | Bacteria | 3542 |
| 10 | Ga0123354_10150659 | 3300010882 | Unclassified | 2819 |
| 11 | Ga0466690_187399 | 3300042590 | Bacteria | 1987 |
| 12 | Ga0466691_055525 | 3300042593 | Unclassified | 7828 |
| 13 | Ga0466691_151509 | 3300042593 | Bacteria | 42451 |
| 14 | Ga0466703_363654 | 3300042636 | Bacteria | 5631 |
| 15 | Ga0466704_301075 | 3300042643 | Bacteria | 4275 |
| 16 | Ga0466704_349181 | 3300042643 | Bacteria | 24462 |
| 17 | Ga0466704_388900 | 3300042643 | Unclassified | 5326 |
| 18 | Ga0466708_244267 | 3300042652 | Bacteria | 2626 |
| 19 | Ga0466713_125009 | 3300042602 | Unclassified | 7357 |
| 20 | Ga0466713_137098 | 3300042602 | Unclassified | 1476 |
| 21 | Ga0466714_020610 | 3300042603 | Bacteria | 12324 |
| 22 | Ga0466719_089955 | 3300042606 | Unclassified | 3954 |
| 23 | Ga0466721_213963 | 3300042608 | Unclassified | 1716 |
| 24 | Ga0466715_332812 | 3300042616 | Bacteria | 62212 |
| 25 | Ga0466715_584264 | 3300042616 | Bacteria | 12619 |
| 26 | Ga0466728_091660 | 3300042620 | Bacteria | 3467 |
| 27 | Ga0466705_015540 | 3300042612 | Bacteria | 18829 |
| 28 | Ga0562379_0180 | 3300056790 | Bacteria | 182121 |
| 29 | Ga0562377_0121 | 3300056842 | Bacteria | 244322 |
| 30 | Ga0562375_0100 | 3300056856 | Bacteria | 265693 |
| 31 | JGI24699J35502_11134017 | 3300002509 | Bacteria | 24388 |
| 32 | Ga0072940_1151472 | 3300005200 | Bacteria | 3571 |
| 33 | Ga0123357_10121303 | 3300009784 | Bacteria | 3292 |
| 34 | Ga0123353_10094807 | 3300010167 | Bacteria | 4808 |
| 35 | Ga0223674_1000915 | 3300021235 | Unclassified | 1797 |
| 36 | Ga0466696_026075 | 3300042596 | Bacteria | 1116 |
| 37 | Ga0466696_505058 | 3300042596 | Bacteria | 7945 |
| 38 | Ga0466704_446954 | 3300042643 | Bacteria | 37901 |
| 39 | Ga0466725_167474 | 3300042654 | Bacteria | 3008 |
| 40 | Ga0466727_007283 | 3300042655 | Bacteria | 19246 |
| 41 | Ga0466706_233243 | 3300042599 | Bacteria | 5803 |
| 42 | Ga0466707_187237 | 3300042601 | Bacteria | 3506 |
| 43 | Ga0466707_233110 | 3300042601 | Bacteria | 1608 |
| 44 | Ga0466707_295226 | 3300042601 | Bacteria | 4408 |
| 45 | Ga0466714_014006 | 3300042603 | Bacteria | 2089 |
| 46 | Ga0466719_156551 | 3300042606 | Unclassified | 2371 |
| 47 | Ga0466719_334198 | 3300042606 | Bacteria | 7146 |
| 48 | Ga0466719_555053 | 3300042606 | Bacteria | 24337 |
| 49 | Ga0466705_522898 | 3300042612 | Unclassified | 2392 |
| 50 | Ga0466712_255903 | 3300042614 | Bacteria | 1009 |
| 51 | Ga0466715_492695 | 3300042616 | Bacteria | 5961 |
| 52 | Ga0466723_074621 | 3300042618 | Unclassified | 15544 |
| 53 | Ga0466723_345015 | 3300042618 | Bacteria | 12488 |
| 54 | Ga0466726_023497 | 3300042619 | Bacteria | 5621 |
| 55 | Ga0466726_284065 | 3300042619 | Bacteria | 4695 |
| 56 | Ga0466726_327413 | 3300042619 | Bacteria | 13549 |
| 57 | Ga0466726_485114 | 3300042619 | Bacteria | 1987 |
| 58 | Ga0466728_060707 | 3300042620 | Bacteria | 27349 |
| 59 | Ga0466728_171952 | 3300042620 | Bacteria | 2255 |
| 60 | Ga0466705_224833 | 3300042612 | Bacteria | 3868 |
| 61 | Ga0466733_138033 | 3300042659 | Bacteria | 29090 |
| 62 | Ga0562375_0096 | 3300056856 | Bacteria | 273717 |
| 63 | Ga0562376_0273 | 3300056857 | Bacteria | 102744 |
| 64 | JGI24695J34938_10007464 | 3300002450 | Bacteria | 6395 |
| 65 | JGI24703J35330_11664407 | 3300002501 | Unclassified | 1680 |
| 66 | Ga0068302_10187104 | 3300005071 | Bacteria | 3148 |
| 67 | Ga0123356_10002174 | 3300010049 | Bacteria | 21095 |
| 68 | Ga0123356_10190435 | 3300010049 | Unclassified | 2082 |
| 69 | Ga0123356_10337851 | 3300010049 | Unclassified | 1625 |
| 70 | Ga0466692_170243 | 3300042591 | Unclassified | 2554 |
| 71 | Ga0466729_288469 | 3300042621 | Unclassified | 2795 |
| 72 | Ga0466704_296827 | 3300042643 | Bacteria | 36648 |
| 73 | Ga0466709_136574 | 3300042648 | Unclassified | 1452 |
| 74 | Ga0466708_212877 | 3300042652 | Bacteria | 79784 |
| 75 | Ga0466707_166918 | 3300042601 | Unclassified | 1176 |
| 76 | Ga0466719_502015 | 3300042606 | Bacteria | 1039 |
| 77 | Ga0466718_041003 | 3300042617 | Bacteria | 24703 |
| 78 | Ga0466718_065610 | 3300042617 | Unclassified | 1951 |
| 79 | Ga0466723_123952 | 3300042618 | Unclassified | 2028 |
| 80 | Ga0466726_064508 | 3300042619 | Bacteria | 29319 |
| 81 | Ga0466705_203071 | 3300042612 | Unclassified | 14274 |
| 82 | Ga0466705_235232 | 3300042612 | Bacteria | 2664 |
| 83 | Ga0562379_0882 | 3300056790 | Unclassified | 44920 |
| 84 | JGI24695J34938_10066072 | 3300002450 | Unclassified | 1525 |
| 85 | Ga0123357_10036318 | 3300009784 | Bacteria | 6705 |
| 86 | Ga0123353_10074434 | 3300010167 | Bacteria | 5460 |
| 87 | Ga0255809_1008327 | 3300022820 | Bacteria | 3082 |
| 88 | Ga0415639_147836 | 3300038395 | Bacteria | 2138 |
| 89 | Ga0466690_015100 | 3300042590 | Bacteria | 9406 |
| 90 | Ga0466695_099614 | 3300042595 | Bacteria | 5169 |
| 91 | Ga0466708_090186 | 3300042652 | Unclassified | 3902 |
| 92 | Ga0466725_272651 | 3300042654 | Bacteria | 1084 |
| 93 | Ga0466714_164771 | 3300042603 | Bacteria | 1115 |
| 94 | Ga0466716_148328 | 3300042605 | Bacteria | 1396 |
| 95 | Ga0466722_101098 | 3300042609 | Bacteria | 11490 |
| 96 | Ga0466722_156559 | 3300042609 | Bacteria | 1157 |
| 97 | Ga0466711_264911 | 3300042615 | Bacteria | 1236 |
| 98 | Ga0466711_318667 | 3300042615 | Bacteria | 2445 |
| 99 | Ga0466711_421026 | 3300042615 | Bacteria | 2857 |
| 100 | Ga0466715_271141 | 3300042616 | Bacteria | 38246 |
| 101 | Ga0466723_122161 | 3300042618 | Unclassified | 7474 |
| 102 | Ga0466723_171803 | 3300042618 | Bacteria | 59143 |
| 103 | Ga0466728_016711 | 3300042620 | Unclassified | 29183 |
| 104 | Ga0466705_103887 | 3300042612 | Unclassified | 2208 |
| 105 | Ga0123357_10157372 | 3300009784 | Bacteria | 2736 |
| 106 | Ga0123355_10090051 | 3300009826 | Bacteria | 4867 |
| 107 | Ga0123356_10482636 | 3300010049 | Bacteria | 1393 |
| 108 | Ga0123353_11162820 | 3300010167 | Bacteria | 1017 |
| 109 | Ga0123354_10342462 | 3300010882 | Bacteria | 1345 |
| 110 | Ga0123354_10485460 | 3300010882 | Bacteria | 974 |
| 111 | Ga0160433_115621 | 3300012846 | Bacteria | 928 |
| 112 | Ga0415639_160293 | 3300038395 | Bacteria | 1045 |
| 113 | Ga0466693_056174 | 3300042592 | Bacteria | 1945 |
| 114 | Ga0466708_391628 | 3300042652 | Bacteria | 1271 |
| 115 | Ga0466727_266265 | 3300042655 | Bacteria | 8007 |
| 116 | Ga0466700_469984 | 3300042600 | Bacteria | 11930 |
| 117 | Ga0466707_257849 | 3300042601 | Bacteria | 10129 |
| 118 | Ga0466707_398469 | 3300042601 | Bacteria | 2149 |
| 119 | Ga0466722_011667 | 3300042609 | Bacteria | 11492 |
| 120 | Ga0466711_099301 | 3300042615 | Bacteria | 13113 |
| 121 | Ga0466711_326056 | 3300042615 | Bacteria | 2484 |
| 122 | Ga0466711_329998 | 3300042615 | Bacteria | 3527 |
| 123 | Ga0466715_596653 | 3300042616 | Bacteria | 14553 |
| 124 | Ga0466718_107131 | 3300042617 | Unclassified | 1144 |
| 125 | Ga0466723_010964 | 3300042618 | Bacteria | 19788 |
| 126 | Ga0466723_271138 | 3300042618 | Unclassified | 7258 |
| 127 | Ga0466726_318623 | 3300042619 | Unclassified | 1195 |
| 128 | Ga0466705_250724 | 3300042612 | Bacteria | 82961 |
| 129 | Ga0466733_158467 | 3300042659 | Bacteria | 10897 |
| 130 | Ga0562379_0083 | 3300056790 | Bacteria | 343504 |
| 131 | Ga0072941_1046791 | 3300005201 | Bacteria | 6703 |
| 132 | Ga0123357_10000620 | 3300009784 | Bacteria | 35228 |
| 133 | Ga0123357_10059632 | 3300009784 | Bacteria | 5120 |
| 134 | Ga0123355_10002977 | 3300009826 | Bacteria | 24075 |
| 135 | Ga0123355_10044320 | 3300009826 | Bacteria | 7241 |
| 136 | Ga0264413_102031 | 3300024493 | Bacteria | 23746 |
| 137 | Ga0247289_2415 | 3300035363 | Bacteria | 1254 |
| 138 | Ga0466692_087893 | 3300042591 | Unclassified | 7459 |
| 139 | Ga0466692_178935 | 3300042591 | Bacteria | 17826 |
| 140 | Ga0466691_181989 | 3300042593 | Bacteria | 31345 |
| 141 | Ga0466696_498014 | 3300042596 | Bacteria | 11596 |
| 142 | Ga0466703_247394 | 3300042636 | Bacteria | 6648 |
| 143 | Ga0466708_179337 | 3300042652 | Bacteria | 29890 |
| 144 | Ga0466708_252186 | 3300042652 | Bacteria | 14225 |
| 145 | Ga0466727_257047 | 3300042655 | Unclassified | 1953 |
| 146 | Ga0466706_030911 | 3300042599 | Bacteria | 1558 |
| 147 | Ga0466700_051311 | 3300042600 | Bacteria | 1720 |
| 148 | Ga0466707_109578 | 3300042601 | Bacteria | 2418 |
| 149 | Ga0466717_173133 | 3300042604 | Bacteria | 9733 |
| 150 | Ga0466722_030474 | 3300042609 | Bacteria | 1507 |
| 151 | Ga0466705_467261 | 3300042612 | Bacteria | 40595 |
| 152 | Ga0466715_194514 | 3300042616 | Bacteria | 13808 |
| 153 | Ga0466729_106339 | 3300042621 | Bacteria | 41427 |
| 154 | Ga0466733_178616 | 3300042659 | Bacteria | 1700 |
| 155 | Ga0562377_0006 | 3300056842 | Bacteria | 3350072 |
| 156 | Ga0562377_0104 | 3300056842 | Unclassified | 275648 |
| 157 | Ga0068305_10107711 | 3300005083 | Bacteria | 2297 |
| 158 | Ga0074307_1116092 | 3300005313 | Bacteria | 1180 |
| 159 | Ga0123357_10086211 | 3300009784 | Bacteria | 4109 |
| 160 | Ga0123357_10146975 | 3300009784 | Bacteria | 2875 |
| 161 | Ga0123356_10945806 | 3300010049 | Unclassified | 1033 |
| 162 | Ga0123353_10000506 | 3300010167 | Bacteria | 48449 |
| 163 | Ga0123353_10075879 | 3300010167 | Bacteria | 5401 |
| 164 | Ga0123353_10298297 | 3300010167 | Bacteria | 2462 |
| 165 | Ga0466693_122642 | 3300042592 | Bacteria | 2605 |
| 166 | Ga0466691_122560 | 3300042593 | Bacteria | 7137 |
| 167 | Ga0466734_113008 | 3300042623 | Bacteria | 1084 |
| 168 | Ga0466703_097247 | 3300042636 | Bacteria | 7328 |
| 169 | Ga0466709_211028 | 3300042648 | Bacteria | 3925 |
| 170 | Ga0466708_186424 | 3300042652 | Bacteria | 4275 |
| 171 | Ga0466713_106963 | 3300042602 | Bacteria | 265396 |
| 172 | Ga0466717_211176 | 3300042604 | Bacteria | 1274 |
| 173 | Ga0466716_190094 | 3300042605 | Bacteria | 7986 |
| 174 | Ga0466719_233678 | 3300042606 | Bacteria | 6381 |
| 175 | Ga0466722_034720 | 3300042609 | Bacteria | 11820 |
| 176 | Ga0466705_411571 | 3300042612 | Bacteria | 9119 |
| 177 | Ga0466705_415445 | 3300042612 | Bacteria | 2302 |
| 178 | Ga0466711_158068 | 3300042615 | Bacteria | 6372 |
| 179 | Ga0466715_314467 | 3300042616 | Bacteria | 26093 |
| 180 | Ga0466715_353133 | 3300042616 | Bacteria | 33453 |
| 181 | Ga0466723_075721 | 3300042618 | Bacteria | 12866 |
| 182 | Ga0466726_255115 | 3300042619 | Bacteria | 3682 |
| 183 | Ga0466728_043373 | 3300042620 | Bacteria | 2947 |
| 184 | Ga0466728_460014 | 3300042620 | Bacteria | 1164 |
| 185 | Ga0562377_0264 | 3300056842 | Bacteria | 116515 |
| 186 | AustNasuHG_c1040408 | 3300000089 | Bacteria | 1141 |
| 187 | JGI24702J35022_10020345 | 3300002462 | Unclassified | 3603 |
| 188 | JGI24702J35022_10046769 | 3300002462 | Bacteria | 2303 |
| 189 | JGI24705J35276_12232421 | 3300002504 | Bacteria | 4325 |
| 190 | CVPL010L_1000205 | 3300002932 | Bacteria | 21696 |
| 191 | Ga0123357_10083810 | 3300009784 | Bacteria | 4182 |
| 192 | Ga0123355_10295001 | 3300009826 | Bacteria | 2219 |
| 193 | Ga0123355_10528709 | 3300009826 | Bacteria | 1438 |
| 194 | Ga0123356_10173153 | 3300010049 | Bacteria | 2172 |
| 195 | Ga0123353_10432793 | 3300010167 | Bacteria | 1945 |
| 196 | Ga0123353_11432985 | 3300010167 | Bacteria | 885 |
| 197 | Ga0466694_388729 | 3300042594 | Bacteria | 1741 |
| 198 | Ga0466696_210140 | 3300042596 | Bacteria | 1143 |
| 199 | Ga0466696_269984 | 3300042596 | Bacteria | 11396 |
| 200 | Ga0466734_039040 | 3300042623 | Bacteria | 1566 |
| 201 | Ga0466704_008544 | 3300042643 | Bacteria | 2638 |
| 202 | Ga0466704_365378 | 3300042643 | Unclassified | 1492 |
| 203 | Ga0466704_547173 | 3300042643 | Bacteria | 2887 |
| 204 | Ga0466709_005451 | 3300042648 | Bacteria | 19590 |
| 205 | Ga0466709_091746 | 3300042648 | Unclassified | 11306 |
| 206 | Ga0466724_23296 | 3300042649 | Bacteria | 4730 |
| 207 | Ga0466708_004448 | 3300042652 | Bacteria | 1689 |
| 208 | Ga0466701_061069 | 3300042598 | Bacteria | 27167 |
| 209 | Ga0466707_085082 | 3300042601 | Bacteria | 1770 |
| 210 | Ga0466707_191217 | 3300042601 | Bacteria | 1052 |
| 211 | Ga0466707_332266 | 3300042601 | Bacteria | 3055 |
| 212 | Ga0466714_028072 | 3300042603 | Unclassified | 1424 |
| 213 | Ga0466714_161956 | 3300042603 | Unclassified | 5431 |
| 214 | Ga0466722_267443 | 3300042609 | Bacteria | 2192 |
| 215 | Ga0466715_610867 | 3300042616 | Bacteria | 1844 |
| 216 | Ga0466718_060799 | 3300042617 | Unclassified | 1566 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00936 | BMC | BMC domain | 35 | 106 | 0.92 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00936 | GO:0031469 | bacterial microcompartment | CC |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.