Protein Family IF09688
Metagenome
Isolate
271
Members
56
Samples
264
Scaffolds
63.88
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_419164|Ga0466709_419164_1008_1238
- Length
- 76 aa
- Sequence
- MSRTCDICGKHTVTGNSVSHAKNRTRRTWKPNLLKVKTEIGGTALTLKICARCLKSDIITKKVSVPRQSGPSTAGQ
Sample Types
Isolate
2.6%
Metagenome
97.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.8%
Kalotermitidae
25.5%
Unclassified
16.4%
Rhinotermitidae
7.3%
Termopsidae
5.5%
Hodotermitidae
1.8%
Blaberidae
1.8%
Taxonomy
Archaea
0
Bacteria
194
Eukaryota
0
Viruses
0
Unclassified
77
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 19 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 20 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 21 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 24 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 25 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 26 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 27 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 28 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 29 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 30 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 31 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 32 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 33 | 2228664003 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA | Metagenome | Termitidae |
| 34 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 35 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 36 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 37 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 38 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 39 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 40 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 41 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 42 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 43 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 44 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 45 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 46 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 47 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 48 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 49 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 50 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 51 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 52 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 53 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 54 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 55 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 56 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_046768 | 3300042601 | Bacteria | 2061 |
| 2 | Ga0466707_078103 | 3300042601 | Unclassified | 3229 |
| 3 | Ga0466707_242470 | 3300042601 | Unclassified | 2020 |
| 4 | Ga0466716_152588 | 3300042605 | Bacteria | 3353 |
| 5 | Ga0466716_417396 | 3300042605 | Bacteria | 1080 |
| 6 | Ga0466719_225352 | 3300042606 | Unclassified | 1839 |
| 7 | Ga0466719_233186 | 3300042606 | Unclassified | 3156 |
| 8 | Ga0466719_262179 | 3300042606 | Unclassified | 1143 |
| 9 | Ga0466722_014260 | 3300042609 | Bacteria | 2823 |
| 10 | Ga0466698_426060 | 3300042610 | Unclassified | 1041 |
| 11 | Ga0466703_085834 | 3300042636 | Bacteria | 4885 |
| 12 | Ga0466703_162814 | 3300042636 | Unclassified | 5449 |
| 13 | Ga0466703_219370 | 3300042636 | Bacteria | 5347 |
| 14 | Ga0466704_034099 | 3300042643 | Bacteria | 2566 |
| 15 | Ga0466704_310263 | 3300042643 | Bacteria | 26336 |
| 16 | Ga0466709_313303 | 3300042648 | Bacteria | 1995 |
| 17 | Ga0466708_001400 | 3300042652 | Unclassified | 1368 |
| 18 | Ga0466708_086832 | 3300042652 | Bacteria | 30549 |
| 19 | Ga0466708_151711 | 3300042652 | Bacteria | 8089 |
| 20 | Ga0466690_183798 | 3300042590 | Bacteria | 2243 |
| 21 | Ga0466692_045527 | 3300042591 | Bacteria | 1487 |
| 22 | Ga0466692_090793 | 3300042591 | Bacteria | 10415 |
| 23 | Ga0466692_138796 | 3300042591 | Bacteria | 17805 |
| 24 | Ga0466692_162522 | 3300042591 | Bacteria | 1320 |
| 25 | Ga0466696_202354 | 3300042596 | Bacteria | 13086 |
| 26 | Ga0466711_031589 | 3300042615 | Bacteria | 25752 |
| 27 | Ga0466715_039967 | 3300042616 | Bacteria | 3443 |
| 28 | Ga0466715_401647 | 3300042616 | Bacteria | 27556 |
| 29 | Ga0466718_096883 | 3300042617 | Unclassified | 7286 |
| 30 | Ga0466723_051506 | 3300042618 | Bacteria | 16324 |
| 31 | Ga0466723_136565 | 3300042618 | Bacteria | 2647 |
| 32 | Ga0466723_206500 | 3300042618 | Bacteria | 1611 |
| 33 | Ga0466723_221245 | 3300042618 | Bacteria | 2748 |
| 34 | Ga0466723_269021 | 3300042618 | Bacteria | 2863 |
| 35 | Ga0466726_070190 | 3300042619 | Bacteria | 1610 |
| 36 | Ga0466728_051506 | 3300042620 | Bacteria | 15989 |
| 37 | Ga0466728_089182 | 3300042620 | Bacteria | 2768 |
| 38 | Ga0466728_473942 | 3300042620 | Bacteria | 11204 |
| 39 | 2230957946 | 2228664003 | Bacteria | 539 |
| 40 | JGI24695J34938_10006308 | 3300002450 | Bacteria | 7171 |
| 41 | JGI24702J35022_10004705 | 3300002462 | Unclassified | 8084 |
| 42 | Ga0466705_313359 | 3300042612 | Unclassified | 1006 |
| 43 | Ga0466722_150446 | 3300042609 | Bacteria | 8142 |
| 44 | Ga0466722_231830 | 3300042609 | Bacteria | 2073 |
| 45 | Ga0466698_170186 | 3300042610 | Bacteria | 1955 |
| 46 | Ga0466703_033077 | 3300042636 | Bacteria | 6958 |
| 47 | Ga0466703_046826 | 3300042636 | Bacteria | 17052 |
| 48 | Ga0466704_027816 | 3300042643 | Bacteria | 11354 |
| 49 | Ga0466704_241753 | 3300042643 | Unclassified | 1432 |
| 50 | Ga0466709_404454 | 3300042648 | Bacteria | 4211 |
| 51 | Ga0466709_419164 | 3300042648 | Bacteria | 1768 |
| 52 | Ga0466708_362931 | 3300042652 | Unclassified | 1595 |
| 53 | Ga0456237_0054154 | 3300041968 | Bacteria | 521 |
| 54 | Ga0466657_040421 | 3300042582 | Bacteria | 1730 |
| 55 | Ga0466692_197890 | 3300042591 | Bacteria | 4994 |
| 56 | Ga0466691_013770 | 3300042593 | Bacteria | 3389 |
| 57 | Ga0466691_029854 | 3300042593 | Bacteria | 6035 |
| 58 | Ga0466694_176028 | 3300042594 | Bacteria | 4091 |
| 59 | Ga0466694_261742 | 3300042594 | Bacteria | 5095 |
| 60 | Ga0466696_188392 | 3300042596 | Bacteria | 5702 |
| 61 | Ga0466696_219921 | 3300042596 | Bacteria | 1206 |
| 62 | Ga0466712_129640 | 3300042614 | Bacteria | 1865 |
| 63 | Ga0466711_230478 | 3300042615 | Unclassified | 1216 |
| 64 | Ga0466723_362225 | 3300042618 | Bacteria | 6301 |
| 65 | JGI24696J40584_12881052 | 3300002834 | Unclassified | 1085 |
| 66 | Ga0072941_1000306 | 3300005201 | Bacteria | 16267 |
| 67 | Ga0466705_071416 | 3300042612 | Bacteria | 2263 |
| 68 | Ga0466732_135958 | 3300042656 | Unclassified | 3244 |
| 69 | Ga0466707_097247 | 3300042601 | Unclassified | 1838 |
| 70 | Ga0466716_276145 | 3300042605 | Unclassified | 5338 |
| 71 | Ga0466719_091182 | 3300042606 | Bacteria | 8781 |
| 72 | Ga0466719_455981 | 3300042606 | Unclassified | 1489 |
| 73 | Ga0466722_123213 | 3300042609 | Bacteria | 10741 |
| 74 | Ga0466729_238797 | 3300042621 | Unclassified | 1074 |
| 75 | Ga0466704_117361 | 3300042643 | Bacteria | 2669 |
| 76 | Ga0466708_158657 | 3300042652 | Unclassified | 3317 |
| 77 | Ga0466708_305142 | 3300042652 | Unclassified | 6792 |
| 78 | Ga0466690_100793 | 3300042590 | Bacteria | 4777 |
| 79 | Ga0466692_172967 | 3300042591 | Bacteria | 17796 |
| 80 | Ga0466692_190713 | 3300042591 | Bacteria | 8828 |
| 81 | Ga0466693_082157 | 3300042592 | Bacteria | 10382 |
| 82 | Ga0466691_117863 | 3300042593 | Bacteria | 11001 |
| 83 | Ga0466711_129609 | 3300042615 | Bacteria | 12996 |
| 84 | Ga0466711_507955 | 3300042615 | Bacteria | 3713 |
| 85 | Ga0466715_012720 | 3300042616 | Bacteria | 11389 |
| 86 | Ga0466715_291814 | 3300042616 | Bacteria | 2706 |
| 87 | Ga0466728_048532 | 3300042620 | Unclassified | 3818 |
| 88 | JGI24695J34938_10002094 | 3300002450 | Bacteria | 15636 |
| 89 | JGI24702J35022_10010666 | 3300002462 | Bacteria | 5134 |
| 90 | JGI24705J35276_11812813 | 3300002504 | Unclassified | 691 |
| 91 | Ga0466705_041001 | 3300042612 | Bacteria | 11975 |
| 92 | Ga0466705_071931 | 3300042612 | Bacteria | 5511 |
| 93 | Ga0466705_120096 | 3300042612 | Bacteria | 1456 |
| 94 | Ga0466732_406807 | 3300042656 | Bacteria | 1750 |
| 95 | Ga0466706_011049 | 3300042599 | Bacteria | 1301 |
| 96 | Ga0466707_050018 | 3300042601 | Bacteria | 1336 |
| 97 | Ga0466707_083854 | 3300042601 | Bacteria | 1046 |
| 98 | Ga0466707_245565 | 3300042601 | Unclassified | 1239 |
| 99 | Ga0466707_349760 | 3300042601 | Unclassified | 1338 |
| 100 | Ga0466716_130093 | 3300042605 | Bacteria | 6515 |
| 101 | Ga0466698_306097 | 3300042610 | Bacteria | 1129 |
| 102 | Ga0466735_043883 | 3300042624 | Bacteria | 1956 |
| 103 | Ga0466703_283293 | 3300042636 | Bacteria | 3091 |
| 104 | Ga0466704_152980 | 3300042643 | Unclassified | 1716 |
| 105 | Ga0466709_065356 | 3300042648 | Bacteria | 16931 |
| 106 | Ga0466708_249144 | 3300042652 | Bacteria | 1112 |
| 107 | Ga0466727_302291 | 3300042655 | Bacteria | 1770 |
| 108 | Ga0466690_322004 | 3300042590 | Bacteria | 2636 |
| 109 | Ga0466693_420416 | 3300042592 | Bacteria | 28518 |
| 110 | Ga0466691_202390 | 3300042593 | Bacteria | 6365 |
| 111 | Ga0466694_025238 | 3300042594 | Bacteria | 1246 |
| 112 | Ga0466696_142098 | 3300042596 | Unclassified | 3546 |
| 113 | Ga0466696_288623 | 3300042596 | Unclassified | 1172 |
| 114 | Ga0466696_397837 | 3300042596 | Unclassified | 6715 |
| 115 | Ga0466696_400279 | 3300042596 | Unclassified | 2449 |
| 116 | Ga0466696_507001 | 3300042596 | Bacteria | 1220 |
| 117 | Ga0466705_430853 | 3300042612 | Unclassified | 2553 |
| 118 | Ga0466705_472383 | 3300042612 | Unclassified | 3831 |
| 119 | Ga0466712_016019 | 3300042614 | Bacteria | 15306 |
| 120 | Ga0466711_061348 | 3300042615 | Bacteria | 11502 |
| 121 | Ga0466711_157151 | 3300042615 | Bacteria | 16598 |
| 122 | Ga0466711_517261 | 3300042615 | Bacteria | 2051 |
| 123 | Ga0466715_034302 | 3300042616 | Unclassified | 1644 |
| 124 | Ga0466715_076872 | 3300042616 | Bacteria | 1596 |
| 125 | Ga0466715_127984 | 3300042616 | Bacteria | 1155 |
| 126 | Ga0466715_254665 | 3300042616 | Bacteria | 14218 |
| 127 | Ga0466715_269695 | 3300042616 | Bacteria | 6165 |
| 128 | Ga0466718_143282 | 3300042617 | Bacteria | 8651 |
| 129 | Ga0466723_240351 | 3300042618 | Bacteria | 9043 |
| 130 | Ga0466726_310638 | 3300042619 | Bacteria | 3261 |
| 131 | Ga0466726_312715 | 3300042619 | Bacteria | 1440 |
| 132 | Ga0466726_448971 | 3300042619 | Bacteria | 6311 |
| 133 | Ga0466726_449104 | 3300042619 | Bacteria | 1913 |
| 134 | Ga0466728_223154 | 3300042620 | Bacteria | 19969 |
| 135 | Ga0466729_187106 | 3300042621 | Unclassified | 1004 |
| 136 | Ga0123353_10100720 | 3300010167 | Bacteria | 4657 |
| 137 | JGI24695J34938_10043260 | 3300002450 | Unclassified | 2010 |
| 138 | Ga0068305_10917943 | 3300005083 | Bacteria | 796 |
| 139 | Ga0072941_1001992 | 3300005201 | Bacteria | 26700 |
| 140 | Ga0072941_1029008 | 3300005201 | Bacteria | 10204 |
| 141 | Ga0466705_163333 | 3300042612 | Bacteria | 8333 |
| 142 | Ga0466705_263792 | 3300042612 | Unclassified | 2993 |
| 143 | Ga0466733_032613 | 3300042659 | Bacteria | 3360 |
| 144 | Ga0466719_387779 | 3300042606 | Unclassified | 5543 |
| 145 | Ga0466720_052248 | 3300042607 | Unclassified | 1598 |
| 146 | Ga0466722_039399 | 3300042609 | Bacteria | 3164 |
| 147 | Ga0466722_124668 | 3300042609 | Bacteria | 42494 |
| 148 | Ga0466722_124756 | 3300042609 | Bacteria | 10630 |
| 149 | Ga0466729_239141 | 3300042621 | Unclassified | 2187 |
| 150 | Ga0466735_166572 | 3300042624 | Unclassified | 1971 |
| 151 | Ga0466703_159507 | 3300042636 | Bacteria | 4680 |
| 152 | Ga0466703_288223 | 3300042636 | Unclassified | 2977 |
| 153 | Ga0466703_312909 | 3300042636 | Bacteria | 1999 |
| 154 | Ga0466708_102204 | 3300042652 | Bacteria | 11616 |
| 155 | Ga0466727_298456 | 3300042655 | Bacteria | 1813 |
| 156 | Ga0466692_027733 | 3300042591 | Bacteria | 5945 |
| 157 | Ga0466695_115400 | 3300042595 | Bacteria | 18917 |
| 158 | Ga0466695_394155 | 3300042595 | Unclassified | 4494 |
| 159 | Ga0466699_064767 | 3300042597 | Bacteria | 2650 |
| 160 | Ga0466712_071980 | 3300042614 | Bacteria | 26800 |
| 161 | Ga0466711_039910 | 3300042615 | Bacteria | 4343 |
| 162 | Ga0466711_177236 | 3300042615 | Bacteria | 2569 |
| 163 | Ga0466723_020453 | 3300042618 | Bacteria | 3201 |
| 164 | Ga0466723_231563 | 3300042618 | Bacteria | 4159 |
| 165 | Ga0466726_019972 | 3300042619 | Bacteria | 4332 |
| 166 | Ga0466726_351539 | 3300042619 | Bacteria | 7415 |
| 167 | Ga0466728_310482 | 3300042620 | Unclassified | 2042 |
| 168 | JGI24698J34947_10152197 | 3300002449 | Unclassified | 959 |
| 169 | Ga0072940_1014403 | 3300005200 | Unclassified | 4551 |
| 170 | Ga0072940_1189925 | 3300005200 | Bacteria | 1168 |
| 171 | Ga0466707_138576 | 3300042601 | Bacteria | 1136 |
| 172 | Ga0466713_050439 | 3300042602 | Bacteria | 3267 |
| 173 | Ga0466716_046752 | 3300042605 | Bacteria | 9936 |
| 174 | Ga0466719_255066 | 3300042606 | Unclassified | 2586 |
| 175 | Ga0466719_357825 | 3300042606 | Bacteria | 1487 |
| 176 | Ga0466722_004906 | 3300042609 | Bacteria | 3655 |
| 177 | Ga0466729_200381 | 3300042621 | Unclassified | 3639 |
| 178 | Ga0466735_070034 | 3300042624 | Bacteria | 7730 |
| 179 | Ga0466704_075070 | 3300042643 | Bacteria | 10097 |
| 180 | Ga0466704_473628 | 3300042643 | Bacteria | 10941 |
| 181 | Ga0466709_279548 | 3300042648 | Bacteria | 7052 |
| 182 | Ga0466708_176720 | 3300042652 | Bacteria | 2116 |
| 183 | Ga0466727_030677 | 3300042655 | Unclassified | 1684 |
| 184 | Ga0466690_016483 | 3300042590 | Unclassified | 5991 |
| 185 | Ga0466690_303131 | 3300042590 | Bacteria | 5294 |
| 186 | Ga0466692_097831 | 3300042591 | Bacteria | 11967 |
| 187 | Ga0466691_170646 | 3300042593 | Unclassified | 1742 |
| 188 | Ga0466691_180989 | 3300042593 | Unclassified | 1639 |
| 189 | Ga0466694_220261 | 3300042594 | Bacteria | 1681 |
| 190 | Ga0466696_106732 | 3300042596 | Bacteria | 20201 |
| 191 | Ga0466696_123610 | 3300042596 | Bacteria | 3146 |
| 192 | Ga0466723_028622 | 3300042618 | Bacteria | 16889 |
| 193 | Ga0466726_220758 | 3300042619 | Bacteria | 8368 |
| 194 | Ga0123353_10282671 | 3300010167 | Unclassified | 2547 |
| 195 | Ga0123354_10396275 | 3300010882 | Unclassified | 1174 |
| 196 | AustNasuHG_c1002186 | 3300000089 | Unclassified | 7068 |
| 197 | JGI24698J34947_10009599 | 3300002449 | Bacteria | 5303 |
| 198 | JGI24702J35022_10994046 | 3300002462 | Unclassified | 522 |
| 199 | Ga0466705_128200 | 3300042612 | Bacteria | 4657 |
| 200 | Ga0466705_197878 | 3300042612 | Bacteria | 1323 |
| 201 | Ga0466706_193039 | 3300042599 | Bacteria | 23529 |
| 202 | Ga0466707_031427 | 3300042601 | Bacteria | 2105 |
| 203 | Ga0466707_269038 | 3300042601 | Unclassified | 1448 |
| 204 | Ga0466716_201052 | 3300042605 | Unclassified | 2344 |
| 205 | Ga0466719_045081 | 3300042606 | Bacteria | 2302 |
| 206 | Ga0466719_125626 | 3300042606 | Bacteria | 6928 |
| 207 | Ga0466719_213856 | 3300042606 | Bacteria | 66888 |
| 208 | Ga0466719_377746 | 3300042606 | Bacteria | 1355 |
| 209 | Ga0466720_119498 | 3300042607 | Unclassified | 4104 |
| 210 | Ga0466698_184019 | 3300042610 | Unclassified | 1100 |
| 211 | Ga0466698_332886 | 3300042610 | Bacteria | 1488 |
| 212 | Ga0466735_056085 | 3300042624 | Bacteria | 16137 |
| 213 | Ga0466709_256145 | 3300042648 | Bacteria | 6055 |
| 214 | Ga0466727_015691 | 3300042655 | Bacteria | 1156 |
| 215 | Ga0466727_027315 | 3300042655 | Bacteria | 3477 |
| 216 | Ga0466690_085907 | 3300042590 | Bacteria | 1583 |
| 217 | Ga0466691_040821 | 3300042593 | Bacteria | 11945 |
| 218 | Ga0466711_079951 | 3300042615 | Bacteria | 16560 |
| 219 | Ga0466715_143940 | 3300042616 | Bacteria | 6598 |
| 220 | Ga0466715_183544 | 3300042616 | Bacteria | 10910 |
| 221 | Ga0466718_005150 | 3300042617 | Bacteria | 28424 |
| 222 | Ga0466718_013475 | 3300042617 | Bacteria | 7726 |
| 223 | Ga0466718_162075 | 3300042617 | Bacteria | 47757 |
| 224 | Ga0466723_129690 | 3300042618 | Unclassified | 3133 |
| 225 | Ga0466726_320433 | 3300042619 | Bacteria | 1524 |
| 226 | Ga0466726_361865 | 3300042619 | Unclassified | 1184 |
| 227 | Ga0466728_420401 | 3300042620 | Unclassified | 1719 |
| 228 | Ga0123357_10188385 | 3300009784 | Bacteria | 2386 |
| 229 | Ga0466705_053740 | 3300042612 | Bacteria | 6375 |
| 230 | Ga0466705_059941 | 3300042612 | Bacteria | 3996 |
| 231 | Ga0466705_239604 | 3300042612 | Unclassified | 5137 |
| 232 | Ga0466707_017608 | 3300042601 | Unclassified | 2019 |
| 233 | Ga0466716_495492 | 3300042605 | Unclassified | 4817 |
| 234 | Ga0466719_295420 | 3300042606 | Unclassified | 1540 |
| 235 | Ga0466719_359229 | 3300042606 | Bacteria | 4302 |
| 236 | Ga0466703_225678 | 3300042636 | Bacteria | 1454 |
| 237 | Ga0466704_129118 | 3300042643 | Bacteria | 2734 |
| 238 | Ga0466704_203783 | 3300042643 | Bacteria | 23097 |
| 239 | Ga0466709_016059 | 3300042648 | Bacteria | 6260 |
| 240 | Ga0466709_017022 | 3300042648 | Unclassified | 1369 |
| 241 | Ga0466709_041072 | 3300042648 | Unclassified | 2691 |
| 242 | Ga0466709_127009 | 3300042648 | Bacteria | 13784 |
| 243 | Ga0466708_002753 | 3300042652 | Bacteria | 2828 |
| 244 | Ga0466708_045285 | 3300042652 | Bacteria | 41948 |
| 245 | Ga0466708_116218 | 3300042652 | Bacteria | 9740 |
| 246 | Ga0466708_349444 | 3300042652 | Unclassified | 6891 |
| 247 | Ga0466690_376333 | 3300042590 | Unclassified | 1998 |
| 248 | Ga0466692_014055 | 3300042591 | Bacteria | 4658 |
| 249 | Ga0466692_160834 | 3300042591 | Bacteria | 1661 |
| 250 | Ga0466691_100346 | 3300042593 | Bacteria | 6161 |
| 251 | Ga0466696_012416 | 3300042596 | Unclassified | 2799 |
| 252 | Ga0466715_591616 | 3300042616 | Bacteria | 8315 |
| 253 | Ga0466723_038155 | 3300042618 | Unclassified | 8622 |
| 254 | Ga0466723_064066 | 3300042618 | Bacteria | 1742 |
| 255 | Ga0466723_262644 | 3300042618 | Bacteria | 11089 |
| 256 | Ga0466728_041236 | 3300042620 | Bacteria | 15095 |
| 257 | Ga0466728_050515 | 3300042620 | Bacteria | 9216 |
| 258 | Ga0466728_432653 | 3300042620 | Unclassified | 1963 |
| 259 | Ga0466729_022385 | 3300042621 | Bacteria | 1006 |
| 260 | Ga0123356_11009596 | 3300010049 | Unclassified | 1002 |
| 261 | Ga0123354_10729090 | 3300010882 | Unclassified | 685 |
| 262 | JGI24698J34947_10001543 | 3300002449 | Bacteria | 12187 |
| 263 | JGI24698J34947_10013201 | 3300002449 | Unclassified | 4513 |
| 264 | JGI24695J34938_10004313 | 3300002450 | Bacteria | 9369 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00830 | Ribosomal_L28 | Ribosomal L28 family | 3 | 56 | 0.97 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00830 | GO:0003735 | structural constituent of ribosome | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.