Protein Family IF09676
Metagenome
Isolate
139
Members
52
Samples
123
Scaffolds
945.28
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_383817|Ga0466709_383817_1005_3950
- Length
- 981 aa
- Sequence
- MARKRKDAGIQPAEEKESPDWPESGCISVWGARVHNLKNIDVELPRNRLSVITGMSGSGKSSLAFDTIFAEGQRRYIETFSAYARHFLGAIERPDVDKITGLSPVISIEQKTTNRNPRSTVGTTTEIYDFFRLLYARAGEAYSYLSGERMVKYTEEQVLELILNEYGGRKIYLLAPLVQNRKGHYKELFEQVRRKGYLNVRVDGELRELVHGMKLDRYRMHSIEVVIDKLKVEATDERRLKKSLRVAMKQGDGLVLVLDVETNEIRYYSRRLMCPVTGLSYSEPAPHRFSFNSPQGACPHCKGLGQVHLPDMEKIVPDPSLSIYNGGIAALGKYRNTLLFWQIESLCGKYGVTLKTPIRDLPAEAMDEIMNGTNDRLPLRNESLGNSGYLFSYEGVAKYILMQQDNDAPAVAQRWAEQFIGTAECPECHGRRLNREALHYRIDGKNIAELSALDVSELVKWADTIENKLSPRQQQIAGEILKEIRSRLRFLLDVGLDYLTPDRASATLSGGESQRIRLATQIGSRLVNVLYILDEPSIGLHQRDNMRLIRSLKDLRDTGNSVVVVEHDREMMLNADYVIDMGPKAGRLGGEIVFAGTPDEMLDTDTLTSSYLNGTRTIPLPPVRRKGSGQWLTLKGATGHNLKKVDVAFPLGTLICVTGVSGSGKSTLVNHTLQPLLSRHFYHSLTMPLPYGSIEGVEYLDKIVNVNQSPIGRSPRSNPATYTGVFSDIRNLFVALPEAKIRGYKPGRFSFNISGGRCEVCKGNGYRVVEMNFLPDVLVPCEECRGKRYNRETLEVRFRGKSIADVLDMTVHMAVEFFEAVPSIFHKIKVLQDVGLGYIKLGQPSSTLSGGESQRVKLATELARRDTGRTLYVLDEPTTGLHFEDIRVLLGVLNQLVDKGNTMIVIEHNLDVIKCADYLIDMGPDGGQKGGHILFTGTPEEMAAAHIQSYTAPFLKKELEMYQSFQGSIIQENEPFESLND
Sample Types
Isolate
11.5%
Metagenome
88.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
26.9%
Blattidae
21.2%
Termitidae
17.3%
Unclassified
13.5%
Rhinotermitidae
7.7%
Termopsidae
5.8%
Passalidae
5.8%
Tenebrionidae
1.9%
Taxonomy
Archaea
0
Bacteria
135
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 2 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 3 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 12 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 13 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 14 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 15 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 18 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 19 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 20 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 21 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 22 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 23 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 26 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 27 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 28 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 29 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 30 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 31 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 32 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 33 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 34 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 35 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 36 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 37 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 38 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 39 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 40 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 41 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 42 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 43 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 44 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 45 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 46 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 47 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 48 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 49 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 50 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 51 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 52 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_030958 | 3300042659 | Bacteria | 11257 |
| 2 | Ga0466705_498486 | 3300042612 | Bacteria | 9191 |
| 3 | Ga0466723_342910 | 3300042618 | Bacteria | 13624 |
| 4 | Ga0466700_376010 | 3300042600 | Bacteria | 38603 |
| 5 | Ga0466700_381027 | 3300042600 | Bacteria | 12866 |
| 6 | Ga0466713_020565 | 3300042602 | Bacteria | 47866 |
| 7 | Ga0068302_10014307 | 3300005071 | Bacteria | 12890 |
| 8 | Ga0068305_10010366 | 3300005083 | Bacteria | 14181 |
| 9 | Ga0466709_362123 | 3300042648 | Bacteria | 19052 |
| 10 | Ga0466690_073286 | 3300042590 | Bacteria | 5619 |
| 11 | Ga0466691_087899 | 3300042593 | Bacteria | 15107 |
| 12 | Ga0466711_295610 | 3300042615 | Bacteria | 14335 |
| 13 | Ga0466711_421713 | 3300042615 | Bacteria | 3461 |
| 14 | Ga0466716_051604 | 3300042605 | Bacteria | 25140 |
| 15 | Ga0466719_459978 | 3300042606 | Bacteria | 14509 |
| 16 | Ga0466722_196218 | 3300042609 | Bacteria | 6535 |
| 17 | Ga0466722_245435 | 3300042609 | Bacteria | 23596 |
| 18 | IMNBL1DRAFT_c0000101 | 3300000062 | Bacteria | 74878 |
| 19 | IMNBL1DRAFT_c0011335 | 3300000062 | Bacteria | 4174 |
| 20 | JGI24705J35276_12238234 | 3300002504 | Bacteria | 17623 |
| 21 | Ga0466703_052468 | 3300042636 | Bacteria | 69521 |
| 22 | Ga0466703_274572 | 3300042636 | Bacteria | 12534 |
| 23 | Ga0466704_218016 | 3300042643 | Bacteria | 40184 |
| 24 | Ga0466690_122651 | 3300042590 | Bacteria | 31212 |
| 25 | Ga0466696_289044 | 3300042596 | Bacteria | 7047 |
| 26 | Ga0123357_10037575 | 3300009784 | Bacteria | 6592 |
| 27 | Ga0466711_045620 | 3300042615 | Bacteria | 22798 |
| 28 | Ga0466711_321203 | 3300042615 | Bacteria | 8765 |
| 29 | Ga0466715_164719 | 3300042616 | Bacteria | 18203 |
| 30 | Ga0466723_055263 | 3300042618 | Bacteria | 32547 |
| 31 | Ga0466726_443560 | 3300042619 | Bacteria | 18845 |
| 32 | Ga0466728_122860 | 3300042620 | Bacteria | 67185 |
| 33 | Ga0466707_107760 | 3300042601 | Bacteria | 9983 |
| 34 | Ga0466713_033740 | 3300042602 | Bacteria | 18936 |
| 35 | Ga0466713_043416 | 3300042602 | Bacteria | 6079 |
| 36 | Ga0466713_133688 | 3300042602 | Bacteria | 5970 |
| 37 | Ga0466716_339636 | 3300042605 | Bacteria | 18089 |
| 38 | Ga0466719_060825 | 3300042606 | Bacteria | 8010 |
| 39 | Ga0466719_423988 | 3300042606 | Bacteria | 5463 |
| 40 | Ga0466722_096933 | 3300042609 | Bacteria | 11285 |
| 41 | 2227549634 | 2225789004 | Bacteria | 15063 |
| 42 | JGI24699J35502_11133458 | 3300002509 | Bacteria | 10767 |
| 43 | Ga0466696_074655 | 3300042596 | Bacteria | 12961 |
| 44 | Ga0466696_108311 | 3300042596 | Bacteria | 8829 |
| 45 | Ga0466733_150744 | 3300042659 | Bacteria | 51643 |
| 46 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 47 | Ga0123354_10023938 | 3300010882 | Bacteria | 9633 |
| 48 | Ga0466711_391154 | 3300042615 | Bacteria | 12882 |
| 49 | Ga0466715_082422 | 3300042616 | Bacteria | 12463 |
| 50 | Ga0466713_110965 | 3300042602 | Bacteria | 66281 |
| 51 | JGI24702J35022_10000687 | 3300002462 | Bacteria | 20622 |
| 52 | JGI24702J35022_10006975 | 3300002462 | Bacteria | 6495 |
| 53 | Ga0466703_033800 | 3300042636 | Bacteria | 21250 |
| 54 | Ga0466704_057310 | 3300042643 | Bacteria | 10748 |
| 55 | Ga0466704_341055 | 3300042643 | Bacteria | 7175 |
| 56 | Ga0466692_184435 | 3300042591 | Bacteria | 106081 |
| 57 | Ga0466691_082219 | 3300042593 | Bacteria | 62191 |
| 58 | Ga0466705_104121 | 3300042612 | Bacteria | 8624 |
| 59 | Ga0466705_191819 | 3300042612 | Bacteria | 7147 |
| 60 | Ga0466705_361326 | 3300042612 | Bacteria | 13383 |
| 61 | Ga0466733_027595 | 3300042659 | Bacteria | 96004 |
| 62 | Ga0466733_144405 | 3300042659 | Bacteria | 17873 |
| 63 | Ga0466705_418678 | 3300042612 | Bacteria | 18793 |
| 64 | Ga0466711_069054 | 3300042615 | Bacteria | 7657 |
| 65 | Ga0466715_046995 | 3300042616 | Bacteria | 9975 |
| 66 | Ga0466707_184663 | 3300042601 | Bacteria | 9319 |
| 67 | 2227494071 | 2225789004 | Bacteria | 20234 |
| 68 | 2227504339 | 2225789004 | Unclassified | 3723 |
| 69 | JGI24699J35502_11133955 | 3300002509 | Bacteria | 21167 |
| 70 | Ga0123357_10000326 | 3300009784 | Bacteria | 45153 |
| 71 | Ga0466704_450066 | 3300042643 | Bacteria | 15714 |
| 72 | Ga0466709_383817 | 3300042648 | Bacteria | 8094 |
| 73 | Ga0466708_021896 | 3300042652 | Bacteria | 36089 |
| 74 | Ga0466708_205257 | 3300042652 | Bacteria | 30810 |
| 75 | Ga0466711_041677 | 3300042615 | Bacteria | 34708 |
| 76 | Ga0466711_114165 | 3300042615 | Bacteria | 4207 |
| 77 | Ga0466715_360218 | 3300042616 | Bacteria | 7203 |
| 78 | Ga0466723_036926 | 3300042618 | Bacteria | 32420 |
| 79 | Ga0466713_061789 | 3300042602 | Bacteria | 88378 |
| 80 | Ga0466713_074190 | 3300042602 | Bacteria | 11761 |
| 81 | Ga0466719_018270 | 3300042606 | Bacteria | 5864 |
| 82 | Ga0466722_056814 | 3300042609 | Bacteria | 80468 |
| 83 | Ga0068305_10030644 | 3300005083 | Unclassified | 7333 |
| 84 | Ga0466703_180144 | 3300042636 | Bacteria | 9697 |
| 85 | Ga0466704_104989 | 3300042643 | Bacteria | 11862 |
| 86 | Ga0466704_296240 | 3300042643 | Bacteria | 16716 |
| 87 | Ga0466704_534273 | 3300042643 | Bacteria | 4957 |
| 88 | Ga0466709_419438 | 3300042648 | Bacteria | 66983 |
| 89 | Ga0466708_185879 | 3300042652 | Bacteria | 12139 |
| 90 | Ga0466727_317540 | 3300042655 | Bacteria | 11618 |
| 91 | Ga0466696_459672 | 3300042596 | Bacteria | 110905 |
| 92 | Ga0466733_209232 | 3300042659 | Bacteria | 28030 |
| 93 | Ga0123357_10013319 | 3300009784 | Bacteria | 10665 |
| 94 | Ga0466711_081357 | 3300042615 | Bacteria | 4099 |
| 95 | Ga0466715_601574 | 3300042616 | Bacteria | 17986 |
| 96 | Ga0466723_011896 | 3300042618 | Bacteria | 13950 |
| 97 | Ga0466726_155838 | 3300042619 | Bacteria | 18951 |
| 98 | Ga0466728_203898 | 3300042620 | Bacteria | 9563 |
| 99 | Ga0466713_008762 | 3300042602 | Bacteria | 34128 |
| 100 | Ga0466722_137339 | 3300042609 | Bacteria | 3412 |
| 101 | Ga0466703_291422 | 3300042636 | Bacteria | 15765 |
| 102 | Ga0466704_246151 | 3300042643 | Bacteria | 6967 |
| 103 | Ga0466708_224946 | 3300042652 | Bacteria | 22929 |
| 104 | Ga0466725_318648 | 3300042654 | Bacteria | 13555 |
| 105 | Ga0466727_020044 | 3300042655 | Bacteria | 42576 |
| 106 | Ga0466727_042118 | 3300042655 | Bacteria | 16826 |
| 107 | Ga0466656_237373 | 3300042550 | Bacteria | 15096 |
| 108 | Ga0466692_038425 | 3300042591 | Bacteria | 7622 |
| 109 | Ga0466696_284492 | 3300042596 | Bacteria | 3633 |
| 110 | Ga0466733_217642 | 3300042659 | Bacteria | 4300 |
| 111 | Ga0466715_079603 | 3300042616 | Bacteria | 222305 |
| 112 | Ga0466715_161567 | 3300042616 | Bacteria | 22971 |
| 113 | Ga0466723_072433 | 3300042618 | Bacteria | 28433 |
| 114 | Ga0466728_053584 | 3300042620 | Bacteria | 26144 |
| 115 | Ga0466707_036218 | 3300042601 | Bacteria | 12429 |
| 116 | Ga0466722_071375 | 3300042609 | Bacteria | 22923 |
| 117 | 2227066904 | 2225789003 | Unclassified | 15156 |
| 118 | IMNBL1DRAFT_c0000880 | 3300000062 | Bacteria | 23420 |
| 119 | IMNBL1DRAFT_c0004652 | 3300000062 | Bacteria | 8145 |
| 120 | JGI24702J35022_10000701 | 3300002462 | Bacteria | 20491 |
| 121 | Ga0466729_223777 | 3300042621 | Unclassified | 7915 |
| 122 | Ga0466703_193916 | 3300042636 | Bacteria | 18273 |
| 123 | Ga0466691_118436 | 3300042593 | Bacteria | 14329 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.