Protein Family IF09668
Metagenome
Isolate
195
Members
59
Samples
190
Scaffolds
297.31
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_346172|Ga0466709_346172_9337_10359
- Length
- 340 aa
- Sequence
- MVLYTVDAGAQPAVVFLPHHHRHHAFRAGMTLFIQYATMLRSTIKPLFYLPIWFFRAKWFGAQRPLQTVLFVSDKCNLTCKHCSIYELRHPHVKTEDQIREELEYSYRLGSRFVDFEGGEPTLWRDGDRDLNSLIRLAKKIGFYSATLTTNAQNPFTGSQADSIWVSLDGLGDYHDRIRGKGAFDRLVKNIATANHPHLSVNMVINAQNDPSVEETIEFAKSNPHIESISLNFHSPYQGTESLFLDWERRARIIDLIIEKKKAGYPVMNSVSGLRLMKHNRFKKQCWVTNFIMPDGTRLTECQGKTAGLCDRCGLSMAGEMHSVFSLKLDTVFAGLKLRM
Sample Types
Isolate
2.6%
Metagenome
97.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.9%
Kalotermitidae
24.6%
Unclassified
12.3%
Termopsidae
7.0%
Rhinotermitidae
5.3%
Passalidae
3.5%
Blattidae
1.8%
Hodotermitidae
1.8%
Taxonomy
Archaea
0
Bacteria
178
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 2 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 14 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 15 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 16 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 17 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 18 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 19 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 20 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 21 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 22 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 23 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 24 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 25 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 26 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 27 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 28 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 29 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 30 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 31 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 32 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 33 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 34 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 36 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 37 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 38 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 39 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 40 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 41 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 42 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 43 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 44 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 45 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 46 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 47 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 48 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 49 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 50 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 51 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 52 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 53 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 54 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 55 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 56 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 57 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 58 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 59 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_018008 | 3300042659 | Bacteria | 16779 |
| 2 | Ga0123357_10011170 | 3300009784 | Bacteria | 11489 |
| 3 | Ga0123353_10036193 | 3300010167 | Unclassified | 7731 |
| 4 | Ga0123353_10156380 | 3300010167 | Unclassified | 3633 |
| 5 | Ga0466710_227339 | 3300042613 | Bacteria | 4634 |
| 6 | Ga0466711_261641 | 3300042615 | Bacteria | 27442 |
| 7 | Ga0466715_596969 | 3300042616 | Bacteria | 24562 |
| 8 | Ga0466723_002535 | 3300042618 | Bacteria | 12675 |
| 9 | Ga0466723_261527 | 3300042618 | Bacteria | 3378 |
| 10 | Ga0466726_313238 | 3300042619 | Bacteria | 7127 |
| 11 | IMNBL1DRAFT_c0011719 | 3300000062 | Bacteria | 4074 |
| 12 | JGI24702J35022_10098110 | 3300002462 | Bacteria | 1601 |
| 13 | JGI24705J35276_12215245 | 3300002504 | Bacteria | 1995 |
| 14 | Ga0466706_136069 | 3300042599 | Bacteria | 6593 |
| 15 | Ga0466714_101534 | 3300042603 | Bacteria | 3667 |
| 16 | Ga0466719_480872 | 3300042606 | Bacteria | 1842 |
| 17 | Ga0466690_384415 | 3300042590 | Bacteria | 23452 |
| 18 | Ga0466696_357819 | 3300042596 | Bacteria | 1838 |
| 19 | Ga0466735_193071 | 3300042624 | Unclassified | 2753 |
| 20 | Ga0466703_338570 | 3300042636 | Bacteria | 1361 |
| 21 | Ga0466703_358940 | 3300042636 | Bacteria | 5652 |
| 22 | Ga0466704_481091 | 3300042643 | Bacteria | 6992 |
| 23 | Ga0466724_60099 | 3300042649 | Bacteria | 1952 |
| 24 | Ga0466705_155248 | 3300042612 | Bacteria | 33316 |
| 25 | Ga0466732_074198 | 3300042656 | Bacteria | 1360 |
| 26 | Ga0466733_195509 | 3300042659 | Bacteria | 83582 |
| 27 | Ga0123353_10509389 | 3300010167 | Bacteria | 1750 |
| 28 | Ga0466715_095522 | 3300042616 | Bacteria | 3852 |
| 29 | 2227255803 | 2225789004 | Bacteria | 7054 |
| 30 | JGI24702J35022_10022287 | 3300002462 | Unclassified | 3430 |
| 31 | JGI24702J35022_10088097 | 3300002462 | Bacteria | 1687 |
| 32 | JGI24705J35276_12238403 | 3300002504 | Bacteria | 21135 |
| 33 | JGI24696J40584_12956844 | 3300002834 | Bacteria | 3258 |
| 34 | Ga0466701_088981 | 3300042598 | Bacteria | 16164 |
| 35 | Ga0466706_136207 | 3300042599 | Bacteria | 30385 |
| 36 | Ga0466707_223703 | 3300042601 | Unclassified | 4238 |
| 37 | Ga0466707_329152 | 3300042601 | Bacteria | 7751 |
| 38 | Ga0466716_161364 | 3300042605 | Bacteria | 12990 |
| 39 | Ga0466719_051482 | 3300042606 | Bacteria | 11957 |
| 40 | Ga0466719_077631 | 3300042606 | Bacteria | 4475 |
| 41 | Ga0466722_036245 | 3300042609 | Bacteria | 21778 |
| 42 | Ga0466722_249425 | 3300042609 | Bacteria | 3468 |
| 43 | Ga0466690_240196 | 3300042590 | Bacteria | 3677 |
| 44 | Ga0466693_334041 | 3300042592 | Bacteria | 1024 |
| 45 | Ga0466691_219407 | 3300042593 | Unclassified | 17502 |
| 46 | Ga0466699_204804 | 3300042597 | Bacteria | 3434 |
| 47 | Ga0466704_078285 | 3300042643 | Bacteria | 2578 |
| 48 | Ga0466724_38105 | 3300042649 | Bacteria | 4109 |
| 49 | Ga0466705_095318 | 3300042612 | Bacteria | 4657 |
| 50 | Ga0466705_260368 | 3300042612 | Bacteria | 1268 |
| 51 | Ga0123357_10393362 | 3300009784 | Bacteria | 1271 |
| 52 | Ga0123353_10036352 | 3300010167 | Bacteria | 7713 |
| 53 | Ga0123353_10440790 | 3300010167 | Bacteria | 1922 |
| 54 | Ga0466715_246897 | 3300042616 | Bacteria | 37494 |
| 55 | Ga0466715_517916 | 3300042616 | Bacteria | 6354 |
| 56 | Ga0466726_460521 | 3300042619 | Unclassified | 5184 |
| 57 | Ga0466706_050887 | 3300042599 | Bacteria | 1545 |
| 58 | Ga0466707_216551 | 3300042601 | Bacteria | 9453 |
| 59 | Ga0466713_099930 | 3300042602 | Bacteria | 46952 |
| 60 | Ga0466716_259355 | 3300042605 | Bacteria | 1573 |
| 61 | Ga0466719_262963 | 3300042606 | Bacteria | 11116 |
| 62 | Ga0466692_094463 | 3300042591 | Bacteria | 8847 |
| 63 | Ga0466693_114125 | 3300042592 | Bacteria | 3274 |
| 64 | Ga0466699_433613 | 3300042597 | Unclassified | 1066 |
| 65 | Ga0466735_037337 | 3300042624 | Bacteria | 1596 |
| 66 | Ga0466704_109164 | 3300042643 | Bacteria | 2418 |
| 67 | Ga0466708_060683 | 3300042652 | Bacteria | 49198 |
| 68 | Ga0466705_285826 | 3300042612 | Bacteria | 1611 |
| 69 | Ga0123353_10163662 | 3300010167 | Bacteria | 3539 |
| 70 | Ga0123354_10244360 | 3300010882 | Bacteria | 1837 |
| 71 | Ga0466711_306020 | 3300042615 | Bacteria | 14460 |
| 72 | Ga0466715_228336 | 3300042616 | Bacteria | 11049 |
| 73 | Ga0466723_025239 | 3300042618 | Bacteria | 67003 |
| 74 | Ga0466726_080715 | 3300042619 | Bacteria | 14865 |
| 75 | JGI24702J35022_10064248 | 3300002462 | Unclassified | 1968 |
| 76 | Ga0068305_10009920 | 3300005083 | Bacteria | 16501 |
| 77 | Ga0068305_10176955 | 3300005083 | Bacteria | 3171 |
| 78 | Ga0072940_1049695 | 3300005200 | Bacteria | 3723 |
| 79 | Ga0466701_099440 | 3300042598 | Bacteria | 19482 |
| 80 | Ga0466707_101212 | 3300042601 | Bacteria | 3512 |
| 81 | Ga0466713_041894 | 3300042602 | Bacteria | 97930 |
| 82 | Ga0466713_078122 | 3300042602 | Unclassified | 7587 |
| 83 | Ga0466716_011158 | 3300042605 | Bacteria | 4328 |
| 84 | Ga0466719_515711 | 3300042606 | Bacteria | 2783 |
| 85 | Ga0466722_059100 | 3300042609 | Bacteria | 1933 |
| 86 | Ga0466697_022554 | 3300042611 | Bacteria | 1053 |
| 87 | Ga0466690_050217 | 3300042590 | Bacteria | 8633 |
| 88 | Ga0466691_094072 | 3300042593 | Bacteria | 8732 |
| 89 | Ga0466696_086569 | 3300042596 | Bacteria | 5963 |
| 90 | Ga0466735_066922 | 3300042624 | Bacteria | 3800 |
| 91 | Ga0466735_090469 | 3300042624 | Bacteria | 8619 |
| 92 | Ga0466735_137983 | 3300042624 | Bacteria | 2995 |
| 93 | Ga0466704_131738 | 3300042643 | Bacteria | 2399 |
| 94 | Ga0466709_164981 | 3300042648 | Bacteria | 4786 |
| 95 | Ga0466708_078638 | 3300042652 | Bacteria | 7362 |
| 96 | Ga0466705_309528 | 3300042612 | Bacteria | 54836 |
| 97 | Ga0466732_187528 | 3300042656 | Bacteria | 3737 |
| 98 | Ga0466715_113262 | 3300042616 | Bacteria | 14729 |
| 99 | Ga0466715_253223 | 3300042616 | Bacteria | 10623 |
| 100 | Ga0466726_021927 | 3300042619 | Bacteria | 10677 |
| 101 | Ga0466726_421046 | 3300042619 | Bacteria | 15138 |
| 102 | Ga0466728_164254 | 3300042620 | Bacteria | 12853 |
| 103 | Ga0466728_232064 | 3300042620 | Unclassified | 3141 |
| 104 | JGI24702J35022_10007885 | 3300002462 | Bacteria | 6062 |
| 105 | JGI24699J35502_11134139 | 3300002509 | Bacteria | 36268 |
| 106 | JGI24696J40584_12958356 | 3300002834 | Bacteria | 4072 |
| 107 | Ga0466706_115523 | 3300042599 | Bacteria | 21375 |
| 108 | Ga0466713_102487 | 3300042602 | Bacteria | 5153 |
| 109 | Ga0466714_169350 | 3300042603 | Bacteria | 2123 |
| 110 | Ga0466719_015962 | 3300042606 | Bacteria | 4192 |
| 111 | Ga0466690_276223 | 3300042590 | Bacteria | 213056 |
| 112 | Ga0466691_010908 | 3300042593 | Bacteria | 139266 |
| 113 | Ga0466703_041467 | 3300042636 | Bacteria | 4955 |
| 114 | Ga0466703_280441 | 3300042636 | Bacteria | 1270 |
| 115 | Ga0466703_387280 | 3300042636 | Bacteria | 1199 |
| 116 | Ga0466704_016556 | 3300042643 | Bacteria | 24571 |
| 117 | Ga0466709_374153 | 3300042648 | Bacteria | 7444 |
| 118 | Ga0466727_005771 | 3300042655 | Bacteria | 3104 |
| 119 | Ga0466727_058007 | 3300042655 | Bacteria | 10793 |
| 120 | Ga0466728_115651 | 3300042620 | Bacteria | 3234 |
| 121 | Ga0466728_464354 | 3300042620 | Bacteria | 2083 |
| 122 | IMNBL1DRAFT_c0000077 | 3300000062 | Bacteria | 88150 |
| 123 | JGI24702J35022_10119742 | 3300002462 | Bacteria | 1454 |
| 124 | JGI24705J35276_12227486 | 3300002504 | Bacteria | 3012 |
| 125 | Ga0466707_119545 | 3300042601 | Bacteria | 13850 |
| 126 | Ga0466690_003078 | 3300042590 | Bacteria | 25930 |
| 127 | Ga0466690_168758 | 3300042590 | Bacteria | 1698 |
| 128 | Ga0466694_049088 | 3300042594 | Bacteria | 2821 |
| 129 | Ga0466696_429416 | 3300042596 | Bacteria | 3696 |
| 130 | Ga0466729_225783 | 3300042621 | Bacteria | 8940 |
| 131 | Ga0466735_038409 | 3300042624 | Bacteria | 3845 |
| 132 | Ga0466702_009067 | 3300042635 | Bacteria | 4172 |
| 133 | Ga0466703_002530 | 3300042636 | Bacteria | 34046 |
| 134 | Ga0466704_308810 | 3300042643 | Bacteria | 2837 |
| 135 | Ga0466704_316954 | 3300042643 | Bacteria | 2218 |
| 136 | Ga0466724_56530 | 3300042649 | Bacteria | 7278 |
| 137 | Ga0466727_155859 | 3300042655 | Unclassified | 2499 |
| 138 | Ga0466715_340747 | 3300042616 | Bacteria | 15029 |
| 139 | Ga0466715_608206 | 3300042616 | Bacteria | 31747 |
| 140 | Ga0466723_335450 | 3300042618 | Bacteria | 9017 |
| 141 | IMNBL1DRAFT_c0000159 | 3300000062 | Bacteria | 59691 |
| 142 | Ga0072941_1039885 | 3300005201 | Bacteria | 9460 |
| 143 | Ga0466706_140986 | 3300042599 | Bacteria | 6831 |
| 144 | Ga0466707_399872 | 3300042601 | Bacteria | 25092 |
| 145 | Ga0466713_076790 | 3300042602 | Bacteria | 9968 |
| 146 | Ga0466716_077005 | 3300042605 | Bacteria | 4285 |
| 147 | Ga0466719_097940 | 3300042606 | Bacteria | 5952 |
| 148 | Ga0466719_390036 | 3300042606 | Bacteria | 1344 |
| 149 | Ga0466721_016798 | 3300042608 | Bacteria | 2193 |
| 150 | Ga0264413_148675 | 3300024493 | Bacteria | 4009 |
| 151 | Ga0466690_021309 | 3300042590 | Bacteria | 12778 |
| 152 | Ga0466695_077786 | 3300042595 | Bacteria | 1103 |
| 153 | Ga0466734_009710 | 3300042623 | Bacteria | 1583 |
| 154 | Ga0466735_045498 | 3300042624 | Bacteria | 3744 |
| 155 | Ga0466735_050026 | 3300042624 | Unclassified | 1670 |
| 156 | Ga0466735_058173 | 3300042624 | Bacteria | 27904 |
| 157 | Ga0466703_073948 | 3300042636 | Bacteria | 5212 |
| 158 | Ga0466727_083717 | 3300042655 | Bacteria | 8189 |
| 159 | Ga0466727_167278 | 3300042655 | Bacteria | 64897 |
| 160 | Ga0466727_225284 | 3300042655 | Bacteria | 1258 |
| 161 | Ga0466733_211188 | 3300042659 | Bacteria | 10118 |
| 162 | Ga0123357_10084476 | 3300009784 | Bacteria | 4160 |
| 163 | Ga0466715_023570 | 3300042616 | Bacteria | 9664 |
| 164 | 2227552970 | 2225789004 | Bacteria | 2825 |
| 165 | JGI24698J34947_10034869 | 3300002449 | Bacteria | 2630 |
| 166 | JGI24702J35022_10000341 | 3300002462 | Bacteria | 27641 |
| 167 | JGI24702J35022_10041880 | 3300002462 | Bacteria | 2440 |
| 168 | Ga0068302_10193390 | 3300005071 | Unclassified | 2310 |
| 169 | Ga0068305_10755418 | 3300005083 | Bacteria | 1294 |
| 170 | Ga0466701_043606 | 3300042598 | Bacteria | 24638 |
| 171 | Ga0466706_214588 | 3300042599 | Bacteria | 7276 |
| 172 | Ga0466707_104581 | 3300042601 | Bacteria | 5436 |
| 173 | Ga0466707_129591 | 3300042601 | Bacteria | 7913 |
| 174 | Ga0466707_171919 | 3300042601 | Bacteria | 1340 |
| 175 | Ga0466713_009402 | 3300042602 | Bacteria | 2777 |
| 176 | Ga0466719_015462 | 3300042606 | Bacteria | 9666 |
| 177 | Ga0466722_056344 | 3300042609 | Bacteria | 10160 |
| 178 | Ga0466690_127833 | 3300042590 | Bacteria | 8393 |
| 179 | Ga0466691_020704 | 3300042593 | Bacteria | 3265 |
| 180 | Ga0466694_108239 | 3300042594 | Bacteria | 3286 |
| 181 | Ga0466731_048037 | 3300042622 | Unclassified | 1101 |
| 182 | Ga0466735_042744 | 3300042624 | Unclassified | 3007 |
| 183 | Ga0466735_227610 | 3300042624 | Unclassified | 2267 |
| 184 | Ga0466730_100610 | 3300042625 | Bacteria | 1355 |
| 185 | Ga0466704_029658 | 3300042643 | Bacteria | 5819 |
| 186 | Ga0466709_039419 | 3300042648 | Bacteria | 67557 |
| 187 | Ga0466709_346172 | 3300042648 | Bacteria | 19067 |
| 188 | Ga0466708_461800 | 3300042652 | Bacteria | 46167 |
| 189 | Ga0466727_048423 | 3300042655 | Bacteria | 3976 |
| 190 | Ga0466727_067586 | 3300042655 | Bacteria | 2070 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04055 | Radical_SAM | Radical SAM superfamily | 72 | 220 | 0.91 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.