Protein Family IF09645
Metagenome
Isolate
201
Members
72
Samples
172
Scaffolds
337.32
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_263807|Ga0466709_263807_6185_7318
- Length
- 377 aa
- Sequence
- MGKKIKIITAMFLNDILLGNKETRRQKTGNKRRGKDEKQAKKFSSFAFLLFPCFLVSFLPACVEIEEYVDTPQGNFEALWKIIDERYCFFDYKEVDWNRIHDEYLRRISNDMNQESLFMLLNEMLQELKDGHVNLTTPFDVGRYWKWFEDYPSNYDESLIRQYLGTDYRIAGSIRYKILDDNIAYLRYADFSSGIGETNLDYIIEKAGICLGMIIDIRDNGGGVLTYSDVFASRFVNEKTLVGYIRHKTGKGHNDFSEPYPKYIEPSSRLRYQKPVVILTNRKCFSTTNDFVNTMGYAPNVTILGDRTGGGSGLPFSSELPNGWSVRFSTCPMFNADMEHLEFGIDPDEPCYLLKEDIHKGKDTLIEKARSLIKERN
Sample Types
Isolate
14.4%
Metagenome
85.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
25.4%
Termitidae
21.1%
Kalotermitidae
19.7%
Unclassified
14.1%
Rhinotermitidae
8.5%
Termopsidae
4.2%
Passalidae
2.8%
Hydrophilidae
1.4%
Hodotermitidae
1.4%
Tenebrionidae
1.4%
Taxonomy
Archaea
0
Bacteria
195
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 2 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 3 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 12 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 13 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 14 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 21 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 22 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 23 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 26 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 27 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 28 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 29 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 30 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 31 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 32 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 33 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 34 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 35 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 36 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 37 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 38 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 39 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 40 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 41 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 42 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 43 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 44 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 45 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 46 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 47 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 48 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 49 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 50 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 51 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 52 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 53 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 54 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 55 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 56 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 57 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 58 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 59 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 60 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 61 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 62 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 63 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 64 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 65 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 66 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 67 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 68 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 69 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 70 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 71 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 72 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466727_350800 | 3300042655 | Bacteria | 2711 |
| 2 | Ga0466733_006107 | 3300042659 | Bacteria | 1387 |
| 3 | Ga0466733_099932 | 3300042659 | Bacteria | 24839 |
| 4 | Ga0466733_154603 | 3300042659 | Bacteria | 23462 |
| 5 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 6 | Ga0466706_166407 | 3300042599 | Bacteria | 20740 |
| 7 | Ga0466707_075398 | 3300042601 | Bacteria | 8912 |
| 8 | Ga0466713_151406 | 3300042602 | Bacteria | 82944 |
| 9 | Ga0466719_550418 | 3300042606 | Bacteria | 4378 |
| 10 | IMNBL1DRAFT_c0001109 | 3300000062 | Bacteria | 20634 |
| 11 | IMNBL1DRAFT_c0050378 | 3300000062 | Bacteria | 1321 |
| 12 | Ga0466726_147793 | 3300042619 | Bacteria | 11298 |
| 13 | Ga0466728_459317 | 3300042620 | Bacteria | 5290 |
| 14 | Ga0123353_10402252 | 3300010167 | Bacteria | 2037 |
| 15 | Ga0123354_10018572 | 3300010882 | Bacteria | 10905 |
| 16 | Ga0123354_10109074 | 3300010882 | Bacteria | 3671 |
| 17 | Ga0466705_276615 | 3300042612 | Bacteria | 2222 |
| 18 | Ga0466703_286961 | 3300042636 | Bacteria | 18817 |
| 19 | Ga0466703_431863 | 3300042636 | Bacteria | 6232 |
| 20 | Ga0466704_036567 | 3300042643 | Bacteria | 7243 |
| 21 | Ga0466727_012010 | 3300042655 | Bacteria | 7360 |
| 22 | Ga0466690_005231 | 3300042590 | Bacteria | 13066 |
| 23 | Ga0466692_050331 | 3300042591 | Bacteria | 31106 |
| 24 | Ga0466692_094763 | 3300042591 | Bacteria | 33557 |
| 25 | Ga0466693_386018 | 3300042592 | Bacteria | 2041 |
| 26 | Ga0466696_073941 | 3300042596 | Bacteria | 3062 |
| 27 | Ga0466706_022572 | 3300042599 | Bacteria | 3078 |
| 28 | Ga0466706_117983 | 3300042599 | Bacteria | 21054 |
| 29 | Ga0466706_138321 | 3300042599 | Bacteria | 12585 |
| 30 | Ga0466706_197390 | 3300042599 | Bacteria | 2278 |
| 31 | Ga0466707_057560 | 3300042601 | Bacteria | 16917 |
| 32 | Ga0466707_096133 | 3300042601 | Bacteria | 3054 |
| 33 | Ga0466713_034002 | 3300042602 | Bacteria | 8993 |
| 34 | Ga0466713_139646 | 3300042602 | Bacteria | 516516 |
| 35 | Ga0466716_165199 | 3300042605 | Bacteria | 5228 |
| 36 | Ga0466716_202600 | 3300042605 | Bacteria | 25648 |
| 37 | Ga0466726_071754 | 3300042619 | Bacteria | 11003 |
| 38 | Ga0466728_064136 | 3300042620 | Bacteria | 50421 |
| 39 | Ga0466728_306930 | 3300042620 | Bacteria | 116996 |
| 40 | Ga0466729_173423 | 3300042621 | Bacteria | 5917 |
| 41 | Ga0123357_10008182 | 3300009784 | Bacteria | 13032 |
| 42 | Ga0466705_209420 | 3300042612 | Unclassified | 3316 |
| 43 | Ga0466735_101674 | 3300042624 | Bacteria | 5313 |
| 44 | Ga0466735_186740 | 3300042624 | Unclassified | 1879 |
| 45 | Ga0466704_492009 | 3300042643 | Bacteria | 4588 |
| 46 | Ga0466709_024483 | 3300042648 | Bacteria | 22052 |
| 47 | Ga0466725_156612 | 3300042654 | Bacteria | 2511 |
| 48 | Ga0466690_254053 | 3300042590 | Bacteria | 10580 |
| 49 | Ga0466691_105692 | 3300042593 | Bacteria | 8969 |
| 50 | Ga0466707_065309 | 3300042601 | Bacteria | 5696 |
| 51 | Ga0466707_318000 | 3300042601 | Bacteria | 2805 |
| 52 | Ga0466707_403545 | 3300042601 | Bacteria | 9865 |
| 53 | Ga0466719_205100 | 3300042606 | Bacteria | 11471 |
| 54 | 2227248328 | 2225789004 | Unclassified | 1324 |
| 55 | 2227480510 | 2225789004 | Bacteria | 4447 |
| 56 | JGI24702J35022_10003146 | 3300002462 | Bacteria | 9981 |
| 57 | Ga0068305_10000024 | 3300005083 | Bacteria | 79054 |
| 58 | Ga0072941_1399755 | 3300005201 | Bacteria | 1298 |
| 59 | Ga0466715_018558 | 3300042616 | Bacteria | 17961 |
| 60 | Ga0466705_312455 | 3300042612 | Bacteria | 5173 |
| 61 | Ga0466703_132815 | 3300042636 | Bacteria | 1521 |
| 62 | Ga0466703_250773 | 3300042636 | Bacteria | 8485 |
| 63 | Ga0466704_244636 | 3300042643 | Bacteria | 19020 |
| 64 | Ga0466708_046422 | 3300042652 | Bacteria | 20392 |
| 65 | Ga0466708_159009 | 3300042652 | Bacteria | 7226 |
| 66 | Ga0466690_060743 | 3300042590 | Bacteria | 7339 |
| 67 | Ga0466696_014961 | 3300042596 | Bacteria | 77550 |
| 68 | Ga0466701_032343 | 3300042598 | Bacteria | 11792 |
| 69 | Ga0466706_219848 | 3300042599 | Bacteria | 17847 |
| 70 | Ga0466707_038125 | 3300042601 | Bacteria | 1858 |
| 71 | Ga0466719_260128 | 3300042606 | Bacteria | 3060 |
| 72 | Ga0466711_199572 | 3300042615 | Bacteria | 17449 |
| 73 | Ga0466715_128059 | 3300042616 | Bacteria | 2908 |
| 74 | Ga0466723_223421 | 3300042618 | Bacteria | 3946 |
| 75 | Ga0466735_041309 | 3300042624 | Bacteria | 3064 |
| 76 | Ga0466735_085212 | 3300042624 | Bacteria | 6769 |
| 77 | Ga0466703_272549 | 3300042636 | Bacteria | 6490 |
| 78 | Ga0466704_215432 | 3300042643 | Bacteria | 4435 |
| 79 | Ga0466727_172428 | 3300042655 | Bacteria | 29494 |
| 80 | Ga0466690_121795 | 3300042590 | Bacteria | 6579 |
| 81 | Ga0466692_026896 | 3300042591 | Bacteria | 2499 |
| 82 | Ga0466691_201737 | 3300042593 | Bacteria | 4851 |
| 83 | Ga0466701_050816 | 3300042598 | Bacteria | 1432 |
| 84 | Ga0466706_106820 | 3300042599 | Bacteria | 11486 |
| 85 | Ga0466706_185118 | 3300042599 | Bacteria | 14790 |
| 86 | Ga0466700_238891 | 3300042600 | Bacteria | 11536 |
| 87 | Ga0466707_073283 | 3300042601 | Bacteria | 1560 |
| 88 | Ga0466713_014552 | 3300042602 | Bacteria | 1384 |
| 89 | Ga0466713_047571 | 3300042602 | Bacteria | 55256 |
| 90 | Ga0466713_127535 | 3300042602 | Bacteria | 10447 |
| 91 | Ga0466713_147626 | 3300042602 | Bacteria | 5759 |
| 92 | Ga0466698_465792 | 3300042610 | Bacteria | 2689 |
| 93 | JGI24699J35502_11134178 | 3300002509 | Bacteria | 45574 |
| 94 | Ga0466715_449037 | 3300042616 | Bacteria | 16321 |
| 95 | Ga0123357_10106735 | 3300009784 | Bacteria | 3589 |
| 96 | Ga0123354_10100796 | 3300010882 | Bacteria | 3906 |
| 97 | Ga0466697_139692 | 3300042611 | Bacteria | 246544 |
| 98 | Ga0466705_268245 | 3300042612 | Bacteria | 6106 |
| 99 | Ga0466703_276157 | 3300042636 | Bacteria | 10545 |
| 100 | Ga0466703_354635 | 3300042636 | Bacteria | 3199 |
| 101 | Ga0466703_387816 | 3300042636 | Bacteria | 1852 |
| 102 | Ga0466704_036083 | 3300042643 | Bacteria | 8019 |
| 103 | Ga0466704_199973 | 3300042643 | Bacteria | 1098 |
| 104 | Ga0466709_393388 | 3300042648 | Bacteria | 7050 |
| 105 | Ga0466690_254247 | 3300042590 | Bacteria | 29646 |
| 106 | Ga0466692_071062 | 3300042591 | Bacteria | 16092 |
| 107 | Ga0466713_006137 | 3300042602 | Bacteria | 25307 |
| 108 | Ga0466713_031124 | 3300042602 | Bacteria | 10723 |
| 109 | Ga0466713_044092 | 3300042602 | Bacteria | 37791 |
| 110 | Ga0466713_063720 | 3300042602 | Bacteria | 27762 |
| 111 | Ga0466716_177329 | 3300042605 | Bacteria | 13283 |
| 112 | Ga0466719_047744 | 3300042606 | Bacteria | 5910 |
| 113 | Ga0466722_009000 | 3300042609 | Bacteria | 22538 |
| 114 | IMNBL1DRAFT_c0007525 | 3300000062 | Bacteria | 5708 |
| 115 | Ga0068305_10252525 | 3300005083 | Bacteria | 2250 |
| 116 | Ga0466705_462556 | 3300042612 | Bacteria | 1255 |
| 117 | Ga0466715_026465 | 3300042616 | Bacteria | 99999 |
| 118 | Ga0466715_580927 | 3300042616 | Bacteria | 12597 |
| 119 | Ga0466728_077153 | 3300042620 | Bacteria | 32982 |
| 120 | Ga0123354_10034285 | 3300010882 | Bacteria | 7938 |
| 121 | Ga0466705_033239 | 3300042612 | Bacteria | 5194 |
| 122 | Ga0466705_128515 | 3300042612 | Bacteria | 6075 |
| 123 | Ga0466705_136696 | 3300042612 | Unclassified | 2503 |
| 124 | Ga0466729_207125 | 3300042621 | Bacteria | 3458 |
| 125 | Ga0466735_132051 | 3300042624 | Bacteria | 7466 |
| 126 | Ga0466704_153053 | 3300042643 | Bacteria | 29430 |
| 127 | Ga0466704_186547 | 3300042643 | Bacteria | 9429 |
| 128 | Ga0466706_022674 | 3300042599 | Bacteria | 12666 |
| 129 | Ga0466706_171967 | 3300042599 | Bacteria | 2336 |
| 130 | Ga0466706_220496 | 3300042599 | Bacteria | 1491 |
| 131 | Ga0466700_355677 | 3300042600 | Bacteria | 7219 |
| 132 | Ga0466707_232640 | 3300042601 | Bacteria | 10806 |
| 133 | Ga0466707_407480 | 3300042601 | Bacteria | 6575 |
| 134 | Ga0466713_085966 | 3300042602 | Bacteria | 3006 |
| 135 | Ga0466713_154523 | 3300042602 | Bacteria | 2129 |
| 136 | 2227133582 | 2225789004 | Bacteria | 8883 |
| 137 | 2227180791 | 2225789004 | Bacteria | 8080 |
| 138 | 2227228888 | 2225789004 | Bacteria | 1369 |
| 139 | JGI24705J35276_12214726 | 3300002504 | Unclassified | 1973 |
| 140 | Ga0466710_050905 | 3300042613 | Bacteria | 10230 |
| 141 | Ga0466711_122606 | 3300042615 | Bacteria | 2531 |
| 142 | Ga0466715_118178 | 3300042616 | Bacteria | 5340 |
| 143 | Ga0123357_10057723 | 3300009784 | Unclassified | 5214 |
| 144 | Ga0466697_142743 | 3300042611 | Bacteria | 3275 |
| 145 | Ga0466705_084572 | 3300042612 | Bacteria | 1454 |
| 146 | Ga0466729_317537 | 3300042621 | Bacteria | 4259 |
| 147 | Ga0466735_141625 | 3300042624 | Bacteria | 2692 |
| 148 | Ga0466703_026949 | 3300042636 | Bacteria | 4053 |
| 149 | Ga0466703_309558 | 3300042636 | Bacteria | 3419 |
| 150 | Ga0466704_116415 | 3300042643 | Bacteria | 3636 |
| 151 | Ga0466709_263807 | 3300042648 | Bacteria | 8178 |
| 152 | Ga0466692_187597 | 3300042591 | Bacteria | 1836 |
| 153 | Ga0466691_162981 | 3300042593 | Bacteria | 7968 |
| 154 | Ga0466707_352479 | 3300042601 | Bacteria | 1824 |
| 155 | Ga0466713_127978 | 3300042602 | Bacteria | 1994 |
| 156 | Ga0466716_169394 | 3300042605 | Bacteria | 10493 |
| 157 | Ga0466719_023689 | 3300042606 | Bacteria | 8986 |
| 158 | Ga0466722_197334 | 3300042609 | Bacteria | 12124 |
| 159 | Ga0466722_264523 | 3300042609 | Bacteria | 1802 |
| 160 | IMNBL1DRAFT_c0000216 | 3300000062 | Bacteria | 50594 |
| 161 | Ga0068305_10051435 | 3300005083 | Bacteria | 4652 |
| 162 | Ga0072941_1202284 | 3300005201 | Bacteria | 1404 |
| 163 | Ga0123357_10000449 | 3300009784 | Bacteria | 39751 |
| 164 | Ga0466711_199870 | 3300042615 | Bacteria | 28300 |
| 165 | Ga0466711_402421 | 3300042615 | Bacteria | 13902 |
| 166 | Ga0466728_412973 | 3300042620 | Bacteria | 5014 |
| 167 | Ga0123357_10267842 | 3300009784 | Bacteria | 1792 |
| 168 | Ga0123356_10247759 | 3300010049 | Bacteria | 1857 |
| 169 | Ga0123354_10010439 | 3300010882 | Bacteria | 14310 |
| 170 | Ga0123354_10182539 | 3300010882 | Bacteria | 2388 |
| 171 | Ga0123354_10282229 | 3300010882 | Bacteria | 1610 |
| 172 | Ga0466705_037841 | 3300042612 | Bacteria | 6743 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.