Protein Family IF09638

Metagenome Metatranscriptome Isolate
201 Members
49 Samples
191 Scaffolds
179.02 Avg Length

🧬 Representative Sequence

ID
3300042648|Ga0466709_246533|Ga0466709_246533_12632_13258
Length
208 aa
Sequence
MLILSGLKKFTPRRIPTLNGEDEKEYGVNHRGGKIRSTTVLVVRRGGKVAMAGDGQVTMGETVMKNNARKVRRLAEGKVLCGFAGATADAFTLFDRFEEKLKEYSGDLRRSAVELAKDWRTDRALRRLEALLLAADHNATLLISGTGDVIEPEGDALAIGSGGNYAYAAALAYLEGSGFSAAEIAEKSLGIAANICIYTNGQITLEEL

📊 Sample Types

Isolate 5.0%
Metagenome 94.5%
MAG 0.0%
Metatranscriptome 0.5%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 32.6%
Kalotermitidae 30.4%
Unclassified 19.6%
Rhinotermitidae 6.5%
Termopsidae 6.5%
Hodotermitidae 2.2%
Blaberidae 2.2%

🌳 Taxonomy

Archaea 0
Bacteria 179
Eukaryota 0
Viruses 0
Unclassified 22

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
2 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
8 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
9 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
10 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 2556921622 Terasakiella pusilla DSM 6293 Isolate Unclassified
13 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
14 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
15 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
16 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
17 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
18 2772190975 Treponema sp. RmG30 Isolate Blaberidae
19 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
20 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
21 650716102 Treponema primitia ZAS-2 Isolate Unclassified
22 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
23 3300021235 Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA Metatranscriptome
24 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
25 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
26 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
27 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
28 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
29 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
30 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
31 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
32 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
33 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
34 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
35 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
36 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
37 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
38 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
39 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
40 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
41 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
42 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
43 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
44 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
45 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
46 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
47 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
48 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
49 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_164302 3300042612 Bacteria 4883
2 Ga0466733_020925 3300042659 Bacteria 34524
3 Ga0466733_043624 3300042659 Bacteria 28843
4 Ga0466703_092266 3300042636 Bacteria 37200
5 Ga0466704_049040 3300042643 Bacteria 14387
6 Ga0466704_082141 3300042643 Bacteria 21700
7 Ga0466704_273943 3300042643 Unclassified 1565
8 Ga0466704_305606 3300042643 Bacteria 29402
9 Ga0466712_176072 3300042614 Bacteria 26085
10 Ga0466718_000308 3300042617 Bacteria 15294
11 JGI24698J34947_10025314 3300002449 Bacteria 3160
12 JGI24698J34947_10028369 3300002449 Bacteria 2964
13 JGI24698J34947_10050011 3300002449 Bacteria 2109
14 JGI24698J34947_10052022 3300002449 Bacteria 2057
15 Ga0072940_1021456 3300005200 Bacteria 20392
16 Ga0466690_055878 3300042590 Unclassified 1720
17 Ga0466694_026162 3300042594 Bacteria 6229
18 Ga0466696_134146 3300042596 Unclassified 4969
19 Ga0466706_122265 3300042599 Bacteria 5004
20 Ga0466716_201114 3300042605 Bacteria 39030
21 Ga0466716_358101 3300042605 Bacteria 17911
22 Ga0466719_135362 3300042606 Bacteria 51759
23 Ga0466722_061542 3300042609 Bacteria 32040
24 Ga0466705_012075 3300042612 Bacteria 2675
25 Ga0466733_114880 3300042659 Bacteria 2057
26 Ga0466702_114022 3300042635 Bacteria 6060
27 Ga0466703_007205 3300042636 Bacteria 42180
28 Ga0466703_324157 3300042636 Bacteria 1650
29 Ga0466704_128155 3300042643 Bacteria 28523
30 Ga0466715_134163 3300042616 Unclassified 1621
31 Ga0466723_013497 3300042618 Bacteria 2608
32 Ga0466726_107131 3300042619 Bacteria 1093
33 Ga0466726_127759 3300042619 Bacteria 20118
34 Ga0466728_237034 3300042620 Bacteria 9493
35 Ga0466728_321611 3300042620 Bacteria 2189
36 JGI24698J34947_10054002 3300002449 Bacteria 2008
37 Ga0072941_1002871 3300005201 Bacteria 36049
38 Ga0072941_1091051 3300005201 Bacteria 5968
39 Ga0466694_267270 3300042594 Bacteria 1928
40 Ga0466696_015896 3300042596 Bacteria 2936
41 Ga0466706_040800 3300042599 Bacteria 3197
42 Ga0466706_065496 3300042599 Bacteria 2207
43 Ga0466706_107786 3300042599 Bacteria 1120
44 Ga0466720_091075 3300042607 Bacteria 5243
45 Ga0466703_409321 3300042636 Bacteria 56299
46 Ga0466704_093587 3300042643 Bacteria 14739
47 Ga0466704_125291 3300042643 Bacteria 4915
48 Ga0466704_148598 3300042643 Unclassified 6292
49 Ga0466709_403724 3300042648 Bacteria 7641
50 Ga0466708_010042 3300042652 Bacteria 27601
51 Ga0466708_300654 3300042652 Bacteria 30678
52 Ga0466705_472413 3300042612 Unclassified 1810
53 Ga0466712_014889 3300042614 Bacteria 58641
54 Ga0466723_140549 3300042618 Unclassified 2955
55 Ga0466723_153245 3300042618 Bacteria 3265
56 Ga0466726_212048 3300042619 Bacteria 1218
57 Ga0466726_235292 3300042619 Bacteria 1543
58 Ga0466726_337549 3300042619 Bacteria 1589
59 Ga0466726_466797 3300042619 Bacteria 2452
60 Ga0466728_280706 3300042620 Unclassified 3393
61 JGI24698J34947_10010002 3300002449 Bacteria 5199
62 JGI24698J34947_10023979 3300002449 Bacteria 3260
63 JGI24698J34947_10042968 3300002449 Bacteria 2319
64 JGI24698J34947_10192401 3300002449 Bacteria 806
65 JGI24695J34938_10024127 3300002450 Bacteria 2924
66 Ga0074263_113140 3300005485 Bacteria 2422
67 Ga0264413_108373 3300024493 Bacteria 5452
68 Ga0466696_377833 3300042596 Bacteria 3384
69 Ga0466699_136032 3300042597 Bacteria 1665
70 Ga0466706_148964 3300042599 Bacteria 1192
71 Ga0466707_263592 3300042601 Bacteria 2416
72 Ga0466707_366442 3300042601 Bacteria 1097
73 Ga0466719_084144 3300042606 Bacteria 12012
74 Ga0466703_007440 3300042636 Bacteria 2187
75 Ga0466703_158700 3300042636 Bacteria 5828
76 Ga0466703_220845 3300042636 Bacteria 51302
77 Ga0466709_345059 3300042648 Unclassified 2208
78 Ga0466727_067983 3300042655 Bacteria 8567
79 Ga0466727_149468 3300042655 Bacteria 2545
80 Ga0466712_133685 3300042614 Bacteria 1096
81 Ga0466712_178477 3300042614 Bacteria 4664
82 Ga0466723_081328 3300042618 Bacteria 12661
83 Ga0466729_173392 3300042621 Bacteria 1124
84 JGI24698J34947_10002431 3300002449 Bacteria 10033
85 JGI24698J34947_10076741 3300002449 Unclassified 1583
86 JGI24699J35502_11115368 3300002509 Unclassified 2912
87 Ga0466693_419846 3300042592 Bacteria 23203
88 Ga0466694_076710 3300042594 Bacteria 2625
89 Ga0466694_223729 3300042594 Unclassified 1664
90 Ga0466696_316255 3300042596 Bacteria 1769
91 Ga0466706_226269 3300042599 Bacteria 1193
92 Ga0466716_093126 3300042605 Bacteria 26989
93 Ga0466719_162738 3300042606 Bacteria 5593
94 Ga0466720_073592 3300042607 Bacteria 36208
95 Ga0466720_088933 3300042607 Bacteria 8147
96 Ga0466705_054661 3300042612 Bacteria 27078
97 Ga0466705_222087 3300042612 Bacteria 4527
98 Ga0466733_103842 3300042659 Bacteria 1143
99 Ga0466703_111886 3300042636 Bacteria 19229
100 Ga0466703_372705 3300042636 Bacteria 3378
101 Ga0466712_021971 3300042614 Bacteria 1209
102 Ga0466718_134708 3300042617 Bacteria 11234
103 Ga0466723_036462 3300042618 Bacteria 18899
104 AustNasuHG_c1000040 3300000089 Bacteria 32335
105 JGI24695J34938_10000165 3300002450 Bacteria 61724
106 JGI24695J34938_10000933 3300002450 Bacteria 26685
107 JGI24695J34938_10010053 3300002450 Bacteria 5214
108 Ga0072941_1001892 3300005201 Bacteria 14106
109 Ga0072941_1006211 3300005201 Bacteria 28326
110 Ga0264413_111156 3300024493 Bacteria 3762
111 Ga0264413_118139 3300024493 Bacteria 7256
112 Ga0466691_196544 3300042593 Bacteria 22060
113 Ga0466696_086690 3300042596 Bacteria 3373
114 Ga0466696_271574 3300042596 Bacteria 3928
115 Ga0466716_011850 3300042605 Bacteria 1363
116 Ga0466705_053793 3300042612 Bacteria 32940
117 Ga0466705_203092 3300042612 Bacteria 17319
118 Ga0466735_018546 3300042624 Bacteria 1222
119 Ga0466735_088766 3300042624 Bacteria 2174
120 Ga0466735_190828 3300042624 Bacteria 2779
121 Ga0466703_014620 3300042636 Bacteria 11910
122 Ga0466703_041012 3300042636 Bacteria 25158
123 Ga0466708_010753 3300042652 Bacteria 16107
124 Ga0466708_038537 3300042652 Bacteria 13838
125 Ga0466727_117146 3300042655 Bacteria 4134
126 Ga0466705_467668 3300042612 Unclassified 1334
127 Ga0466712_132707 3300042614 Unclassified 2638
128 Ga0466723_007474 3300042618 Bacteria 2174
129 Ga0466723_359383 3300042618 Bacteria 7053
130 JGI24698J34947_10005006 3300002449 Bacteria 7262
131 JGI24698J34947_10033692 3300002449 Bacteria 2685
132 JGI24698J34947_10035790 3300002449 Unclassified 2588
133 JGI24698J34947_10066903 3300002449 Unclassified 1746
134 JGI24695J34938_10001107 3300002450 Bacteria 24311
135 Ga0264413_101606 3300024493 Bacteria 1840
136 Ga0466690_138314 3300042590 Bacteria 1812
137 Ga0466693_429074 3300042592 Bacteria 2103
138 Ga0466696_044118 3300042596 Bacteria 8531
139 Ga0466696_218972 3300042596 Bacteria 19000
140 Ga0466720_076003 3300042607 Bacteria 34599
141 Ga0466705_127577 3300042612 Bacteria 32685
142 Ga0466705_176547 3300042612 Bacteria 2184
143 Ga0466703_049531 3300042636 Bacteria 42822
144 Ga0466709_280168 3300042648 Bacteria 28407
145 Ga0466708_019469 3300042652 Bacteria 3264
146 Ga0466708_086152 3300042652 Bacteria 9560
147 Ga0466712_129146 3300042614 Bacteria 7663
148 Ga0466712_264052 3300042614 Unclassified 2029
149 Ga0466711_183178 3300042615 Bacteria 53190
150 Ga0466715_199866 3300042616 Bacteria 13252
151 Ga0466718_086776 3300042617 Bacteria 73105
152 Ga0466726_441461 3300042619 Bacteria 3626
153 Ga0466728_013152 3300042620 Bacteria 2970
154 Ga0466728_056459 3300042620 Unclassified 1926
155 AustNasuHG_c1005488 3300000089 Bacteria 4532
156 JGI24695J34938_10000021 3300002450 Bacteria 112419
157 JGI24695J34938_10000049 3300002450 Bacteria 91446
158 JGI24695J34938_10015085 3300002450 Bacteria 3977
159 Ga0072941_1002872 3300005201 Bacteria 18952
160 Ga0466690_002538 3300042590 Bacteria 8784
161 Ga0466690_088451 3300042590 Bacteria 1784
162 Ga0466691_028375 3300042593 Bacteria 17257
163 Ga0466696_075410 3300042596 Bacteria 18499
164 Ga0466696_114663 3300042596 Bacteria 1482
165 Ga0466696_423691 3300042596 Bacteria 31979
166 Ga0466706_051236 3300042599 Bacteria 1305
167 Ga0466716_119703 3300042605 Bacteria 6564
168 Ga0466705_030354 3300042612 Bacteria 9527
169 Ga0466709_246533 3300042648 Bacteria 16446
170 Ga0466709_402278 3300042648 Bacteria 13984
171 Ga0466708_038229 3300042652 Bacteria 8156
172 Ga0466712_155558 3300042614 Bacteria 36572
173 Ga0466712_317085 3300042614 Unclassified 1907
174 Ga0466718_045163 3300042617 Bacteria 3037
175 Ga0466723_315269 3300042618 Unclassified 2546
176 Ga0123356_10427459 3300010049 Bacteria 1468
177 AustNasuHG_c1000440 3300000089 Bacteria 14540
178 JGI24698J34947_10005031 3300002449 Bacteria 7243
179 JGI24698J34947_10015688 3300002449 Bacteria 4120
180 JGI24698J34947_10054010 3300002449 Bacteria 2008
181 JGI24695J34938_10004155 3300002450 Bacteria 9633
182 Ga0223674_1029558 3300021235 Bacteria 2068
183 Ga0466690_045541 3300042590 Unclassified 1530
184 Ga0466690_242095 3300042590 Bacteria 1400
185 Ga0466692_051344 3300042591 Bacteria 2445
186 Ga0466692_116356 3300042591 Bacteria 4872
187 Ga0466692_204049 3300042591 Bacteria 14250
188 Ga0466691_031910 3300042593 Bacteria 45146
189 Ga0466696_138618 3300042596 Bacteria 4277
190 Ga0466699_011532 3300042597 Unclassified 1537
191 Ga0466719_214454 3300042606 Bacteria 1861

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00227 Proteasome Proteasome subunit 37 206 0.96

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.