Protein Family IF09629
Metagenome
Isolate
110
Members
29
Samples
107
Scaffolds
225.49
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_220718|Ga0466709_220718_4039_4806
- Length
- 255 aa
- Sequence
- MIIPMAFTLANYLVLCYGMSGLWVLAFLIFVSALPVFLAILWYRLSRFPLSPLQCSLALMAGAAALFPALLLQRFLTGIHAAEPGLWSPAADVFIRIALTEELSRLLALLFFFVLSGDLKKSGPGPDAETAFPPADPAARGAAIGLLAGLGFAMLESAVYGAADFRIALPRAFTAAPLHGACGARVGAALLIFGRQPRRGVFRFFSAVLIHGVYNIMIVRSGLPSLLAVLIALSALASSALEIRGGMKSAETPGP
Sample Types
Isolate
2.7%
Metagenome
97.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
48.3%
Termitidae
17.2%
Unclassified
17.2%
Rhinotermitidae
13.8%
Termopsidae
3.4%
Taxonomy
Archaea
0
Bacteria
106
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 4 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 5 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 8 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 9 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 16 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 20 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 21 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 22 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 23 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 24 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 25 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 26 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 27 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 28 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 29 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10018998 | 3300009826 | Bacteria | 10931 |
| 2 | Ga0123355_10175294 | 3300009826 | Bacteria | 3195 |
| 3 | Ga0466715_361239 | 3300042616 | Bacteria | 18181 |
| 4 | Ga0466715_538875 | 3300042616 | Bacteria | 1357 |
| 5 | Ga0466726_160612 | 3300042619 | Bacteria | 1401 |
| 6 | Ga0466719_101431 | 3300042606 | Bacteria | 2831 |
| 7 | Ga0466719_564790 | 3300042606 | Bacteria | 7113 |
| 8 | Ga0466703_113916 | 3300042636 | Bacteria | 10140 |
| 9 | Ga0466704_322829 | 3300042643 | Bacteria | 2575 |
| 10 | Ga0466696_103360 | 3300042596 | Bacteria | 3225 |
| 11 | Ga0466696_128218 | 3300042596 | Bacteria | 3243 |
| 12 | Ga0466696_466265 | 3300042596 | Bacteria | 3132 |
| 13 | Ga0466715_295713 | 3300042616 | Bacteria | 14746 |
| 14 | Ga0466715_590078 | 3300042616 | Bacteria | 6872 |
| 15 | Ga0466723_065503 | 3300042618 | Bacteria | 10421 |
| 16 | Ga0466723_091898 | 3300042618 | Bacteria | 26162 |
| 17 | Ga0466723_209397 | 3300042618 | Bacteria | 2417 |
| 18 | Ga0466723_214465 | 3300042618 | Bacteria | 3074 |
| 19 | Ga0466723_362706 | 3300042618 | Bacteria | 3104 |
| 20 | Ga0466726_083268 | 3300042619 | Bacteria | 1836 |
| 21 | Ga0466716_077154 | 3300042605 | Bacteria | 5400 |
| 22 | Ga0466719_105254 | 3300042606 | Bacteria | 2954 |
| 23 | Ga0466703_296916 | 3300042636 | Bacteria | 11746 |
| 24 | Ga0466704_084592 | 3300042643 | Bacteria | 10392 |
| 25 | Ga0466709_408063 | 3300042648 | Bacteria | 1247 |
| 26 | Ga0466708_423761 | 3300042652 | Bacteria | 4226 |
| 27 | Ga0456237_0007992 | 3300041968 | Bacteria | 1614 |
| 28 | Ga0466691_037060 | 3300042593 | Bacteria | 4121 |
| 29 | Ga0466711_503189 | 3300042615 | Bacteria | 26467 |
| 30 | Ga0466715_290357 | 3300042616 | Bacteria | 3441 |
| 31 | Ga0466723_088276 | 3300042618 | Bacteria | 5455 |
| 32 | Ga0466719_095084 | 3300042606 | Unclassified | 17689 |
| 33 | Ga0466722_009215 | 3300042609 | Bacteria | 1827 |
| 34 | Ga0466722_104979 | 3300042609 | Bacteria | 4791 |
| 35 | Ga0466704_004835 | 3300042643 | Bacteria | 1593 |
| 36 | Ga0466704_165954 | 3300042643 | Bacteria | 3707 |
| 37 | Ga0466704_323227 | 3300042643 | Bacteria | 1503 |
| 38 | Ga0466708_242484 | 3300042652 | Bacteria | 7159 |
| 39 | Ga0456237_0001190 | 3300041968 | Bacteria | 4112 |
| 40 | Ga0466690_331235 | 3300042590 | Bacteria | 1828 |
| 41 | Ga0466690_386704 | 3300042590 | Bacteria | 2463 |
| 42 | Ga0466696_146782 | 3300042596 | Bacteria | 1574 |
| 43 | Ga0466705_137835 | 3300042612 | Bacteria | 7328 |
| 44 | Ga0466711_194986 | 3300042615 | Bacteria | 8935 |
| 45 | Ga0466711_308760 | 3300042615 | Bacteria | 1523 |
| 46 | Ga0466715_104049 | 3300042616 | Bacteria | 14846 |
| 47 | Ga0466726_162133 | 3300042619 | Bacteria | 1554 |
| 48 | Ga0466726_327498 | 3300042619 | Bacteria | 11899 |
| 49 | Ga0466729_002706 | 3300042621 | Bacteria | 2428 |
| 50 | Ga0068305_10139288 | 3300005083 | Bacteria | 13307 |
| 51 | Ga0466709_393744 | 3300042648 | Bacteria | 2531 |
| 52 | Ga0466708_396293 | 3300042652 | Bacteria | 7752 |
| 53 | Ga0466708_440984 | 3300042652 | Bacteria | 1097 |
| 54 | Ga0466691_203490 | 3300042593 | Bacteria | 13335 |
| 55 | Ga0466696_474446 | 3300042596 | Unclassified | 2323 |
| 56 | Ga0123356_10070569 | 3300010049 | Bacteria | 3277 |
| 57 | Ga0466715_271735 | 3300042616 | Bacteria | 2281 |
| 58 | Ga0466723_067632 | 3300042618 | Bacteria | 2512 |
| 59 | Ga0466728_164147 | 3300042620 | Bacteria | 12427 |
| 60 | Ga0466707_172754 | 3300042601 | Bacteria | 1604 |
| 61 | Ga0466716_182067 | 3300042605 | Bacteria | 3510 |
| 62 | Ga0466719_371831 | 3300042606 | Bacteria | 1318 |
| 63 | Ga0466703_292580 | 3300042636 | Bacteria | 1357 |
| 64 | Ga0466709_331797 | 3300042648 | Bacteria | 29309 |
| 65 | Ga0466708_148633 | 3300042652 | Bacteria | 11322 |
| 66 | Ga0466690_024310 | 3300042590 | Bacteria | 4333 |
| 67 | Ga0466692_081393 | 3300042591 | Bacteria | 2809 |
| 68 | Ga0466696_037428 | 3300042596 | Bacteria | 12157 |
| 69 | Ga0466715_300410 | 3300042616 | Bacteria | 12625 |
| 70 | Ga0466715_413134 | 3300042616 | Bacteria | 19075 |
| 71 | Ga0466715_422523 | 3300042616 | Bacteria | 2307 |
| 72 | Ga0466723_113190 | 3300042618 | Bacteria | 2887 |
| 73 | Ga0466707_240072 | 3300042601 | Unclassified | 1194 |
| 74 | Ga0466707_400093 | 3300042601 | Bacteria | 13448 |
| 75 | Ga0466716_153807 | 3300042605 | Bacteria | 2434 |
| 76 | AustNasuHG_c1001404 | 3300000089 | Bacteria | 8616 |
| 77 | Ga0466704_372694 | 3300042643 | Bacteria | 6899 |
| 78 | Ga0466709_146817 | 3300042648 | Bacteria | 30075 |
| 79 | Ga0466690_309056 | 3300042590 | Bacteria | 6605 |
| 80 | Ga0466694_036068 | 3300042594 | Bacteria | 1718 |
| 81 | Ga0466696_197330 | 3300042596 | Bacteria | 2411 |
| 82 | Ga0466705_125846 | 3300042612 | Bacteria | 5864 |
| 83 | Ga0466723_023563 | 3300042618 | Unclassified | 1641 |
| 84 | Ga0466723_035249 | 3300042618 | Bacteria | 15913 |
| 85 | Ga0466723_272744 | 3300042618 | Bacteria | 1530 |
| 86 | Ga0466723_283500 | 3300042618 | Bacteria | 4589 |
| 87 | Ga0466719_104467 | 3300042606 | Bacteria | 52022 |
| 88 | Ga0466709_168007 | 3300042648 | Bacteria | 17356 |
| 89 | Ga0466709_220718 | 3300042648 | Bacteria | 10276 |
| 90 | Ga0466696_029653 | 3300042596 | Bacteria | 3222 |
| 91 | Ga0466699_275009 | 3300042597 | Bacteria | 1456 |
| 92 | Ga0466705_001165 | 3300042612 | Bacteria | 6993 |
| 93 | Ga0466705_401651 | 3300042612 | Bacteria | 6814 |
| 94 | Ga0466715_160864 | 3300042616 | Bacteria | 4644 |
| 95 | Ga0466726_187479 | 3300042619 | Bacteria | 2311 |
| 96 | Ga0466726_440825 | 3300042619 | Bacteria | 1052 |
| 97 | Ga0466716_084434 | 3300042605 | Bacteria | 2514 |
| 98 | Ga0466719_041107 | 3300042606 | Bacteria | 9469 |
| 99 | Ga0466719_254672 | 3300042606 | Bacteria | 14947 |
| 100 | Ga0466704_093281 | 3300042643 | Bacteria | 4878 |
| 101 | Ga0466709_246399 | 3300042648 | Bacteria | 2170 |
| 102 | Ga0466709_366036 | 3300042648 | Bacteria | 1269 |
| 103 | Ga0466708_138778 | 3300042652 | Bacteria | 7501 |
| 104 | Ga0466690_130414 | 3300042590 | Bacteria | 3357 |
| 105 | Ga0466691_005824 | 3300042593 | Bacteria | 6667 |
| 106 | Ga0466691_008151 | 3300042593 | Bacteria | 2762 |
| 107 | Ga0466699_008399 | 3300042597 | Bacteria | 7065 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13367 | PrsW-protease | PrsW family intramembrane metalloprotease | 57 | 233 | 0.86 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF13367 | GO:0008233 | peptidase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.