Protein Family IF09614
Metagenome
Isolate
136
Members
43
Samples
132
Scaffolds
192.38
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_167094|Ga0466709_167094_1319_1897
- Length
- 177 aa
- Sequence
- MDWTFNIKDFVSAFIVLFAIIDVSGSLPIFVDLKNKNKSFSPLKASLLAFFFVGEGILRLFNVDVSSFAVAGSLVLFVIACEMTFGVEIFKMDSPTSSATMVPVIFPLLAGPGAFTALLSLKAEYSSLVIILAIVLWRVNLIEKLIGAGGVYVLRKFFGIILLAISAKLFMGNITLL
Sample Types
Isolate
2.9%
Metagenome
97.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
32.6%
Termitidae
27.9%
Unclassified
14.0%
Termopsidae
9.3%
Rhinotermitidae
7.0%
Passalidae
4.7%
Blattidae
2.3%
Hodotermitidae
2.3%
Taxonomy
Archaea
0
Bacteria
128
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 2 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 10 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 11 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 12 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 15 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 16 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 17 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 18 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 19 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 20 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 21 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 22 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 23 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 24 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 25 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 26 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 27 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 28 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 29 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 30 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 31 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 32 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 33 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 34 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 35 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 36 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 37 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 38 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 39 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 40 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 41 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 42 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 43 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466715_220088 | 3300042616 | Bacteria | 21738 |
| 2 | Ga0466701_049400 | 3300042598 | Bacteria | 1741 |
| 3 | Ga0466706_185768 | 3300042599 | Unclassified | 1370 |
| 4 | Ga0466707_022690 | 3300042601 | Bacteria | 15610 |
| 5 | Ga0466719_313001 | 3300042606 | Bacteria | 17722 |
| 6 | Ga0466703_146142 | 3300042636 | Bacteria | 4729 |
| 7 | Ga0466703_411727 | 3300042636 | Unclassified | 2960 |
| 8 | Ga0466704_273784 | 3300042643 | Unclassified | 4997 |
| 9 | Ga0466709_243801 | 3300042648 | Bacteria | 109845 |
| 10 | IMNBL1DRAFT_c0008364 | 3300000062 | Bacteria | 5274 |
| 11 | Ga0466697_089909 | 3300042611 | Bacteria | 1123 |
| 12 | Ga0466715_095832 | 3300042616 | Bacteria | 10625 |
| 13 | Ga0466715_347763 | 3300042616 | Bacteria | 4996 |
| 14 | Ga0466723_129762 | 3300042618 | Bacteria | 6447 |
| 15 | Ga0466701_091833 | 3300042598 | Bacteria | 1288 |
| 16 | Ga0466701_100075 | 3300042598 | Bacteria | 1229 |
| 17 | Ga0466700_139869 | 3300042600 | Bacteria | 5254 |
| 18 | Ga0466707_062515 | 3300042601 | Bacteria | 19268 |
| 19 | Ga0466716_187453 | 3300042605 | Bacteria | 14311 |
| 20 | Ga0466719_500894 | 3300042606 | Bacteria | 5139 |
| 21 | Ga0466735_126051 | 3300042624 | Bacteria | 4642 |
| 22 | Ga0466735_169248 | 3300042624 | Bacteria | 1288 |
| 23 | Ga0466727_130490 | 3300042655 | Bacteria | 3239 |
| 24 | Ga0466727_203810 | 3300042655 | Bacteria | 6610 |
| 25 | Ga0466705_373818 | 3300042612 | Bacteria | 18025 |
| 26 | Ga0123357_10049328 | 3300009784 | Unclassified | 5701 |
| 27 | Ga0123357_10384085 | 3300009784 | Bacteria | 1299 |
| 28 | Ga0123356_10416612 | 3300010049 | Bacteria | 1484 |
| 29 | Ga0123354_10003998 | 3300010882 | Bacteria | 20665 |
| 30 | Ga0466726_266728 | 3300042619 | Bacteria | 3732 |
| 31 | Ga0466692_117229 | 3300042591 | Bacteria | 56912 |
| 32 | Ga0466707_035868 | 3300042601 | Bacteria | 5454 |
| 33 | Ga0466707_037216 | 3300042601 | Bacteria | 1301 |
| 34 | Ga0466707_170429 | 3300042601 | Bacteria | 10238 |
| 35 | Ga0466707_241759 | 3300042601 | Bacteria | 17311 |
| 36 | Ga0466722_085596 | 3300042609 | Bacteria | 1535 |
| 37 | Ga0466722_165738 | 3300042609 | Bacteria | 25578 |
| 38 | Ga0466698_255996 | 3300042610 | Bacteria | 1459 |
| 39 | Ga0466735_165935 | 3300042624 | Bacteria | 1845 |
| 40 | Ga0466704_319388 | 3300042643 | Bacteria | 1942 |
| 41 | Ga0466709_167094 | 3300042648 | Bacteria | 7391 |
| 42 | Ga0466727_124195 | 3300042655 | Bacteria | 107642 |
| 43 | Ga0466705_338893 | 3300042612 | Bacteria | 11291 |
| 44 | Ga0123357_10015402 | 3300009784 | Unclassified | 10023 |
| 45 | Ga0123353_10486196 | 3300010167 | Bacteria | 1804 |
| 46 | Ga0123354_10025067 | 3300010882 | Bacteria | 9405 |
| 47 | Ga0123354_10154043 | 3300010882 | Bacteria | 2767 |
| 48 | Ga0466715_259115 | 3300042616 | Bacteria | 4413 |
| 49 | Ga0466715_500083 | 3300042616 | Bacteria | 5001 |
| 50 | Ga0466726_090145 | 3300042619 | Bacteria | 14217 |
| 51 | Ga0466728_424066 | 3300042620 | Bacteria | 2456 |
| 52 | Ga0466690_061550 | 3300042590 | Bacteria | 26019 |
| 53 | Ga0466692_140423 | 3300042591 | Bacteria | 16022 |
| 54 | Ga0466692_167389 | 3300042591 | Bacteria | 6083 |
| 55 | Ga0466696_202133 | 3300042596 | Bacteria | 4570 |
| 56 | Ga0466707_311275 | 3300042601 | Bacteria | 1593 |
| 57 | Ga0466713_087936 | 3300042602 | Bacteria | 6062 |
| 58 | Ga0466722_009206 | 3300042609 | Bacteria | 29346 |
| 59 | Ga0466704_456616 | 3300042643 | Bacteria | 35507 |
| 60 | JGI24699J35502_11134124 | 3300002509 | Bacteria | 34130 |
| 61 | Ga0068302_10524873 | 3300005071 | Bacteria | 1203 |
| 62 | Ga0123356_10006359 | 3300010049 | Bacteria | 11913 |
| 63 | Ga0123353_10335408 | 3300010167 | Bacteria | 2286 |
| 64 | Ga0123353_10439487 | 3300010167 | Bacteria | 1925 |
| 65 | Ga0466726_041756 | 3300042619 | Bacteria | 1371 |
| 66 | Ga0466692_043899 | 3300042591 | Bacteria | 67267 |
| 67 | Ga0466692_184027 | 3300042591 | Bacteria | 1459 |
| 68 | Ga0466707_112391 | 3300042601 | Bacteria | 11861 |
| 69 | Ga0466707_176204 | 3300042601 | Bacteria | 3431 |
| 70 | Ga0466713_125567 | 3300042602 | Bacteria | 2899 |
| 71 | Ga0466722_230306 | 3300042609 | Bacteria | 4777 |
| 72 | Ga0466734_113356 | 3300042623 | Bacteria | 2643 |
| 73 | Ga0466735_005506 | 3300042624 | Bacteria | 2799 |
| 74 | Ga0466735_095551 | 3300042624 | Bacteria | 1957 |
| 75 | Ga0466735_119845 | 3300042624 | Bacteria | 1932 |
| 76 | Ga0466703_035424 | 3300042636 | Bacteria | 4790 |
| 77 | Ga0466703_406596 | 3300042636 | Bacteria | 2023 |
| 78 | Ga0466704_164604 | 3300042643 | Bacteria | 18380 |
| 79 | Ga0466708_146236 | 3300042652 | Bacteria | 6526 |
| 80 | 2227441906 | 2225789004 | Bacteria | 25850 |
| 81 | 2227546020 | 2225789004 | Bacteria | 2920 |
| 82 | IMNBL1DRAFT_c0000764 | 3300000062 | Bacteria | 25441 |
| 83 | Ga0068302_10035013 | 3300005071 | Bacteria | 8885 |
| 84 | Ga0466705_219437 | 3300042612 | Unclassified | 1323 |
| 85 | Ga0123356_10145292 | 3300010049 | Bacteria | 2346 |
| 86 | Ga0466723_095077 | 3300042618 | Bacteria | 3737 |
| 87 | Ga0466726_079746 | 3300042619 | Bacteria | 2213 |
| 88 | Ga0466690_373916 | 3300042590 | Bacteria | 40566 |
| 89 | Ga0466692_019635 | 3300042591 | Bacteria | 1239 |
| 90 | Ga0466692_143025 | 3300042591 | Bacteria | 2598 |
| 91 | Ga0466691_092862 | 3300042593 | Bacteria | 14737 |
| 92 | Ga0466713_149966 | 3300042602 | Bacteria | 6880 |
| 93 | Ga0466729_219588 | 3300042621 | Bacteria | 3998 |
| 94 | Ga0466729_298617 | 3300042621 | Bacteria | 2482 |
| 95 | Ga0466734_081052 | 3300042623 | Bacteria | 1296 |
| 96 | Ga0466735_150289 | 3300042624 | Bacteria | 1717 |
| 97 | Ga0466704_583464 | 3300042643 | Bacteria | 34188 |
| 98 | JGI24699J35502_11134037 | 3300002509 | Bacteria | 25927 |
| 99 | Ga0068305_10126923 | 3300005083 | Bacteria | 6033 |
| 100 | Ga0123357_10004638 | 3300009784 | Bacteria | 16215 |
| 101 | Ga0123357_10773959 | 3300009784 | Bacteria | 659 |
| 102 | Ga0123356_10135131 | 3300010049 | Bacteria | 2423 |
| 103 | Ga0123354_10197424 | 3300010882 | Bacteria | 2226 |
| 104 | Ga0123354_10583451 | 3300010882 | Bacteria | 827 |
| 105 | Ga0466707_274678 | 3300042601 | Unclassified | 1724 |
| 106 | Ga0466719_460020 | 3300042606 | Bacteria | 7296 |
| 107 | Ga0466719_505790 | 3300042606 | Bacteria | 8367 |
| 108 | Ga0466735_091393 | 3300042624 | Bacteria | 2585 |
| 109 | Ga0466735_110024 | 3300042624 | Bacteria | 5631 |
| 110 | Ga0466735_226949 | 3300042624 | Bacteria | 1239 |
| 111 | Ga0466708_221268 | 3300042652 | Bacteria | 13982 |
| 112 | JGI24696J40584_12933959 | 3300002834 | Bacteria | 1530 |
| 113 | Ga0068305_10046343 | 3300005083 | Bacteria | 3419 |
| 114 | Ga0466705_144072 | 3300042612 | Bacteria | 11569 |
| 115 | Ga0123357_10008295 | 3300009784 | Bacteria | 12964 |
| 116 | Ga0123357_10155245 | 3300009784 | Bacteria | 2763 |
| 117 | Ga0123354_10065814 | 3300010882 | Bacteria | 5300 |
| 118 | Ga0466711_021889 | 3300042615 | Bacteria | 32119 |
| 119 | Ga0466711_178990 | 3300042615 | Bacteria | 9408 |
| 120 | Ga0466715_169397 | 3300042616 | Bacteria | 1674 |
| 121 | Ga0466691_161680 | 3300042593 | Bacteria | 8234 |
| 122 | Ga0466713_058280 | 3300042602 | Bacteria | 24824 |
| 123 | Ga0466713_111128 | 3300042602 | Bacteria | 15728 |
| 124 | Ga0466716_313507 | 3300042605 | Bacteria | 6921 |
| 125 | Ga0466729_203014 | 3300042621 | Bacteria | 7591 |
| 126 | Ga0466735_061695 | 3300042624 | Bacteria | 9727 |
| 127 | Ga0466703_010285 | 3300042636 | Bacteria | 3132 |
| 128 | Ga0466703_024045 | 3300042636 | Bacteria | 1631 |
| 129 | Ga0466704_337559 | 3300042643 | Unclassified | 3932 |
| 130 | Ga0466725_440777 | 3300042654 | Bacteria | 1445 |
| 131 | Ga0466727_140347 | 3300042655 | Bacteria | 3402 |
| 132 | Ga0068305_10442926 | 3300005083 | Bacteria | 1010 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01914 | MarC | MarC family integral membrane protein | 8 | 174 | 0.85 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01914 | GO:0016020 | membrane | CC |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.