Protein Family IF09612

Metagenome Metatranscriptome Isolate
310 Members
85 Samples
283 Scaffolds
222.05 Avg Length

🧬 Representative Sequence

ID
3300042648|Ga0466709_158916|Ga0466709_158916_3433_4248
Length
260 aa
Sequence
MIVVKNLFKKMLCIGTSSARPRMAHRTGPEVKNLDRLNNPEYTAPMYLDTYYLILVVPTIFLSLWAQFTVKSAFSKYSKIRCSRGITGAAAAQILMDANNISDVRIEQVAGSLTDHYDPAHRVLRLSQPVYGEPSIAAVGVAAHETGHAIQHARGYGPLGLRSTLVPVANIGSSIGPWLALGGLVAGFPFLLTLGIILFAGAVAFYLITLPVEFNASARALAILKQNQVLDSRELAGVKKVLSAAAMTYVRLILLSRRRH

πŸ“Š Sample Types

Isolate 8.7%
Metagenome 91.0%
MAG 0.0%
Metatranscriptome 0.3%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 42.2%
Unclassified 28.9%
Kalotermitidae 16.9%
Rhinotermitidae 3.6%
Termopsidae 3.6%
Calliphoridae 1.2%
Scarabaeidae 1.2%
Tenebrionidae 1.2%
Passalidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 278
Eukaryota 0
Viruses 0
Unclassified 32

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
2 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
3 2820321184 Unclassified Firmicutes Nt197P3bin86 Isolate Unclassified
4 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
5 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
6 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
7 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
8 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
9 2593339124 Clostridium sp. 4 Isolate Termitidae
10 2820724199 Unclassified Cloacimonetes Th196P3bin22 Isolate Unclassified
11 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
12 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
13 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
14 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
15 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
16 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
17 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
18 2820813074 Unclassified Actinobacteria Nt197P3bin52 Isolate Unclassified
19 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
20 2590828839 Clostridium sp. 1 Isolate Termitidae
21 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
22 2820254385 Unclassified Firmicutes Th196P3bin54 Isolate Unclassified
23 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
24 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
25 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
26 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
27 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
28 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
29 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
30 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
31 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
32 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
33 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
34 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
35 2820811576 Unclassified Actinobacteria Nt197P3bin53 Isolate Unclassified
36 2590828840 Clostridium sp. 2 Isolate Termitidae
37 2634166424 Clostridium sp. L74 Isolate Scarabaeidae
38 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
39 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
40 2820350530 Unclassified Firmicutes Nt197P3bin37 Isolate Unclassified
41 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
42 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
43 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
44 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
45 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
46 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
47 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
48 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
49 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
50 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
51 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
52 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
53 2820866620 Unclassified Actinobacteria Lab288P3bin139 Isolate Unclassified
54 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
55 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
56 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
57 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
58 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
59 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
60 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
61 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
62 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
63 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
64 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
65 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
66 2820344559 Unclassified Firmicutes Nt197P3bin63 Isolate Unclassified
67 2820647881 Unclassified Firmicutes Cu122P5bin16 Isolate Unclassified
68 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
69 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
70 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
71 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
72 2820380671 Unclassified Firmicutes Nt197P1bin4 Isolate Unclassified
73 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
74 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
75 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
76 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
77 3300021238 Termite gut microbial communities from nest - French Guiana - 6_6 mRNA SA Metatranscriptome Termitidae
78 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
79 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
80 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
81 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
82 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
83 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
84 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
85 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_413195 3300042656 Unclassified 6909
2 Ga0264413_110358 3300024493 Bacteria 12968
3 Ga0466690_388029 3300042590 Unclassified 1588
4 Ga0466692_080320 3300042591 Bacteria 36899
5 Ga0466693_077194 3300042592 Bacteria 21406
6 Ga0466693_379155 3300042592 Bacteria 1058
7 Ga0466691_007602 3300042593 Unclassified 1088
8 Ga0466699_144688 3300042597 Bacteria 2300
9 Ga0466717_030593 3300042604 Unclassified 2979
10 Ga0466719_320130 3300042606 Unclassified 1953
11 Ga0466719_456824 3300042606 Bacteria 13119
12 Ga0466719_485823 3300042606 Bacteria 8981
13 Ga0466722_036568 3300042609 Bacteria 2628
14 Ga0466722_079405 3300042609 Bacteria 6823
15 JGI24698J34947_10070961 3300002449 Bacteria 1674
16 Ga0072940_1036595 3300005200 Bacteria 3801
17 Ga0072941_1005107 3300005201 Bacteria 20281
18 Ga0072941_1074915 3300005201 Unclassified 4060
19 Ga0466735_219655 3300042624 Bacteria 5544
20 Ga0466703_025704 3300042636 Bacteria 95958
21 Ga0466704_149580 3300042643 Bacteria 17340
22 Ga0466709_071710 3300042648 Bacteria 8781
23 Ga0466709_163049 3300042648 Bacteria 27099
24 Ga0466725_043503 3300042654 Bacteria 1249
25 Ga0466712_069354 3300042614 Bacteria 2863
26 Ga0466712_096443 3300042614 Unclassified 6056
27 Ga0466712_109162 3300042614 Bacteria 6414
28 Ga0466712_209275 3300042614 Bacteria 9430
29 Ga0466715_291663 3300042616 Bacteria 2938
30 Ga0466723_038578 3300042618 Bacteria 3149
31 Ga0466723_121736 3300042618 Bacteria 1122
32 Ga0223681_1005369 3300021238 Bacteria 1663
33 Ga0415639_059218 3300038395 Bacteria 2154
34 Ga0466690_021750 3300042590 Bacteria 10945
35 Ga0466699_046170 3300042597 Bacteria 10961
36 Ga0123355_10007506 3300009826 Bacteria 16354
37 Ga0123353_10033172 3300010167 Bacteria 8034
38 Ga0466700_396806 3300042600 Bacteria 1477
39 Ga0466713_084750 3300042602 Bacteria 8483
40 Ga0466721_278559 3300042608 Bacteria 1520
41 Ga0466722_065079 3300042609 Bacteria 5282
42 AustNasuHG_c1000367 3300000089 Bacteria 15638
43 AustNasuHG_c1001045 3300000089 Bacteria 9962
44 AustNasuHG_c1002136 3300000089 Bacteria 7142
45 AustNasuHG_c1007904 3300000089 Bacteria 3771
46 JGI24698J34947_10011714 3300002449 Bacteria 4816
47 JGI24698J34947_10028976 3300002449 Bacteria 2929
48 JGI24702J35022_10002023 3300002462 Bacteria 12494
49 Ga0072940_1022677 3300005200 Bacteria 29727
50 Ga0072941_1004651 3300005201 Bacteria 14259
51 Ga0072941_1023296 3300005201 Bacteria 1389
52 Ga0072941_1041651 3300005201 Bacteria 7686
53 Ga0072941_1110148 3300005201 Bacteria 5652
54 Ga0466735_023146 3300042624 Bacteria 10947
55 Ga0466702_325681 3300042635 Bacteria 1276
56 Ga0466703_174554 3300042636 Bacteria 29909
57 Ga0466704_396270 3300042643 Bacteria 41737
58 Ga0466727_181644 3300042655 Bacteria 1683
59 Ga0466712_018664 3300042614 Bacteria 4783
60 Ga0466712_112979 3300042614 Bacteria 2831
61 Ga0466712_123454 3300042614 Unclassified 2807
62 Ga0466712_210387 3300042614 Bacteria 3403
63 Ga0466711_068019 3300042615 Bacteria 10252
64 Ga0466711_483637 3300042615 Bacteria 1076
65 Ga0466715_135735 3300042616 Bacteria 9043
66 Ga0466715_344593 3300042616 Unclassified 2846
67 Ga0466715_523174 3300042616 Bacteria 1308
68 Ga0466715_529016 3300042616 Bacteria 3741
69 Ga0466718_086156 3300042617 Bacteria 4707
70 Ga0466718_100233 3300042617 Bacteria 3720
71 Ga0466723_232679 3300042618 Bacteria 4221
72 Ga0466726_276820 3300042619 Bacteria 3600
73 Ga0466726_420195 3300042619 Bacteria 2254
74 Ga0466727_350630 3300042655 Bacteria 1237
75 Ga0466732_455816 3300042656 Bacteria 1438
76 Ga0466692_019543 3300042591 Bacteria 1101
77 Ga0466699_141604 3300042597 Bacteria 3964
78 Ga0466699_353824 3300042597 Bacteria 3407
79 Ga0466699_442349 3300042597 Bacteria 14365
80 Ga0123353_10146324 3300010167 Bacteria 3777
81 Ga0466701_037826 3300042598 Bacteria 1025
82 Ga0466700_353947 3300042600 Bacteria 1057
83 Ga0466716_275640 3300042605 Bacteria 10726
84 Ga0466720_034169 3300042607 Bacteria 1695
85 Ga0466720_075940 3300042607 Bacteria 13266
86 Ga0466720_114834 3300042607 Bacteria 2588
87 Ga0466720_186762 3300042607 Bacteria 15310
88 Ga0466722_021973 3300042609 Bacteria 8920
89 Ga0466722_023053 3300042609 Bacteria 2465
90 Ga0466698_240595 3300042610 Bacteria 1152
91 JGI24698J34947_10003654 3300002449 Unclassified 8353
92 JGI24698J34947_10011109 3300002449 Bacteria 4942
93 JGI24695J34938_10000485 3300002450 Unclassified 38557
94 JGI24702J35022_10030198 3300002462 Bacteria 2908
95 Ga0072940_1165518 3300005200 Bacteria 1421
96 Ga0072941_1037637 3300005201 Bacteria 7295
97 Ga0466731_164426 3300042622 Bacteria 14856
98 Ga0466731_301131 3300042622 Bacteria 3851
99 Ga0466731_317654 3300042622 Bacteria 1176
100 Ga0466735_044238 3300042624 Bacteria 1736
101 Ga0466703_109340 3300042636 Bacteria 9695
102 Ga0466703_141846 3300042636 Bacteria 4062
103 Ga0466703_192353 3300042636 Bacteria 6084
104 Ga0466703_257935 3300042636 Bacteria 1613
105 Ga0466709_158916 3300042648 Bacteria 35318
106 Ga0466709_401872 3300042648 Bacteria 1390
107 Ga0466727_313517 3300042655 Bacteria 1896
108 Ga0466712_010094 3300042614 Bacteria 5748
109 Ga0466712_042192 3300042614 Unclassified 3739
110 Ga0466712_067097 3300042614 Unclassified 2218
111 Ga0466712_120077 3300042614 Bacteria 8532
112 Ga0466718_033907 3300042617 Bacteria 28713
113 Ga0466723_088666 3300042618 Unclassified 1875
114 Ga0466705_227110 3300042612 Bacteria 9868
115 Ga0466693_249702 3300042592 Bacteria 3239
116 Ga0466695_221990 3300042595 Bacteria 77793
117 Ga0466699_208758 3300042597 Bacteria 1134
118 Ga0466699_360871 3300042597 Bacteria 1697
119 Ga0123355_10004597 3300009826 Bacteria 20065
120 Ga0123353_10317344 3300010167 Bacteria 2367
121 Ga0123353_10356407 3300010167 Bacteria 2201
122 Ga0466700_091937 3300042600 Bacteria 2316
123 Ga0466717_035249 3300042604 Bacteria 1811
124 Ga0466719_199985 3300042606 Bacteria 3184
125 Ga0466720_039852 3300042607 Bacteria 3307
126 Ga0466722_188485 3300042609 Bacteria 26025
127 AustNasuHG_c1002579 3300000089 Bacteria 6542
128 AustNasuHG_c1013831 3300000089 Bacteria 2758
129 JGI24698J34947_10022980 3300002449 Bacteria 3338
130 JGI24698J34947_10040413 3300002449 Bacteria 2408
131 JGI24695J34938_10000403 3300002450 Bacteria 42148
132 Ga0072941_1008723 3300005201 Bacteria 6351
133 Ga0466704_317418 3300042643 Unclassified 2777
134 Ga0466708_321737 3300042652 Bacteria 61371
135 Ga0466708_389577 3300042652 Bacteria 54586
136 Ga0466725_173280 3300042654 Bacteria 4521
137 Ga0466712_038490 3300042614 Bacteria 2845
138 Ga0466711_284745 3300042615 Bacteria 2182
139 Ga0466715_032569 3300042616 Bacteria 9902
140 Ga0466715_110852 3300042616 Bacteria 6336
141 Ga0466718_067678 3300042617 Bacteria 1154
142 Ga0466723_021073 3300042618 Bacteria 30395
143 Ga0466723_324785 3300042618 Bacteria 11375
144 Ga0466726_081873 3300042619 Bacteria 5558
145 Ga0466726_267542 3300042619 Bacteria 5329
146 Ga0466705_147961 3300042612 Bacteria 3649
147 Ga0415639_010949 3300038395 Bacteria 19628
148 Ga0466692_094488 3300042591 Unclassified 1030
149 Ga0466694_398198 3300042594 Bacteria 2204
150 Ga0466696_346398 3300042596 Bacteria 18868
151 Ga0466699_012397 3300042597 Bacteria 1564
152 Ga0466699_091474 3300042597 Bacteria 2294
153 Ga0466699_119345 3300042597 Bacteria 2485
154 Ga0466699_198257 3300042597 Bacteria 6049
155 Ga0123353_10261794 3300010167 Bacteria 2671
156 Ga0123353_10700397 3300010167 Bacteria 1422
157 Ga0466716_423240 3300042605 Bacteria 4584
158 Ga0466719_356933 3300042606 Bacteria 21887
159 Ga0466719_387698 3300042606 Bacteria 10621
160 Ga0466720_168636 3300042607 Bacteria 1004
161 JGI24698J34947_10012342 3300002449 Unclassified 4682
162 JGI24698J34947_10013962 3300002449 Bacteria 4377
163 JGI24698J34947_10015366 3300002449 Bacteria 4168
164 JGI24698J34947_10021840 3300002449 Unclassified 3439
165 JGI24695J34938_10004341 3300002450 Bacteria 9337
166 JGI24695J34938_10015732 3300002450 Bacteria 3872
167 JGI24699J35502_11133733 3300002509 Bacteria 14455
168 Ga0072941_1065721 3300005201 Bacteria 4253
169 Ga0466705_404410 3300042612 Bacteria 1193
170 Ga0466715_062239 3300042616 Bacteria 9585
171 Ga0466715_496464 3300042616 Bacteria 6437
172 Ga0466718_074471 3300042617 Unclassified 1588
173 Ga0466718_075327 3300042617 Bacteria 8975
174 Ga0466728_078526 3300042620 Bacteria 1983
175 Ga0466732_310043 3300042656 Bacteria 9300
176 Ga0466732_409936 3300042656 Bacteria 1731
177 Ga0562377_0006 3300056842 Bacteria 3350072
178 Ga0466692_001596 3300042591 Bacteria 5390
179 Ga0466691_165191 3300042593 Bacteria 3959
180 Ga0466696_041825 3300042596 Bacteria 1423
181 Ga0466696_342530 3300042596 Bacteria 1318
182 Ga0466699_030715 3300042597 Bacteria 8240
183 Ga0466699_051177 3300042597 Bacteria 5398
184 Ga0466699_122834 3300042597 Bacteria 2000
185 Ga0466699_374435 3300042597 Bacteria 5818
186 Ga0123357_10301745 3300009784 Bacteria 1616
187 Ga0466700_301349 3300042600 Bacteria 2407
188 Ga0466717_031667 3300042604 Unclassified 4662
189 Ga0466716_227546 3300042605 Bacteria 7896
190 Ga0466719_219551 3300042606 Bacteria 10831
191 Ga0466720_020438 3300042607 Bacteria 42880
192 Ga0466720_088992 3300042607 Bacteria 4181
193 Ga0466722_075956 3300042609 Bacteria 5792
194 Ga0466722_152320 3300042609 Bacteria 3368
195 JGI24702J35022_10150273 3300002462 Bacteria 1306
196 Ga0072940_1096145 3300005200 Bacteria 4183
197 Ga0072941_1041625 3300005201 Bacteria 3037
198 Ga0466731_287683 3300042622 Bacteria 2417
199 Ga0466703_344664 3300042636 Bacteria 5045
200 Ga0466709_061723 3300042648 Bacteria 3566
201 Ga0466712_132603 3300042614 Unclassified 3239
202 Ga0466712_138285 3300042614 Unclassified 7450
203 Ga0466711_032090 3300042615 Bacteria 5872
204 Ga0466718_063157 3300042617 Bacteria 1959
205 Ga0466718_083006 3300042617 Bacteria 2181
206 Ga0466723_065796 3300042618 Bacteria 3291
207 Ga0466728_206531 3300042620 Bacteria 1551
208 Ga0466728_296707 3300042620 Bacteria 18805
209 Ga0466692_171787 3300042591 Bacteria 1010
210 Ga0466691_083549 3300042593 Bacteria 6036
211 Ga0466691_217709 3300042593 Bacteria 28640
212 Ga0466699_378658 3300042597 Bacteria 8679
213 Ga0123356_10041491 3300010049 Bacteria 4287
214 Ga0123353_11078385 3300010167 Bacteria 1069
215 Ga0123354_10374145 3300010882 Bacteria 1239
216 Ga0466707_005890 3300042601 Bacteria 5692
217 Ga0466719_234209 3300042606 Unclassified 1911
218 Ga0466719_418804 3300042606 Bacteria 1627
219 Ga0466719_554039 3300042606 Unclassified 3024
220 Ga0466720_006235 3300042607 Bacteria 3238
221 Ga0466720_213686 3300042607 Bacteria 2153
222 Ga0466722_014246 3300042609 Bacteria 18174
223 Ga0466722_052243 3300042609 Bacteria 23183
224 IMNBL1DRAFT_c0028955 3300000062 Bacteria 2057
225 JGI24698J34947_10019077 3300002449 Bacteria 3703
226 JGI24698J34947_10020510 3300002449 Bacteria 3558
227 JGI24698J34947_10097875 3300002449 Bacteria 1327
228 JGI24698J34947_10121988 3300002449 Bacteria 1129
229 JGI24695J34938_10005364 3300002450 Bacteria 8014
230 JGI24695J34938_10056672 3300002450 Unclassified 1688
231 JGI24697J35500_11016921 3300002507 Unclassified 973
232 Ga0072940_1033290 3300005200 Bacteria 1551
233 Ga0072941_1107128 3300005201 Bacteria 3480
234 Ga0072941_1109416 3300005201 Bacteria 4767
235 Ga0466729_223148 3300042621 Bacteria 1012
236 Ga0466735_066425 3300042624 Bacteria 33205
237 Ga0466704_094999 3300042643 Bacteria 61949
238 Ga0466708_369999 3300042652 Bacteria 3308
239 Ga0466708_417592 3300042652 Bacteria 3671
240 Ga0466712_024591 3300042614 Bacteria 1553
241 Ga0466712_033366 3300042614 Bacteria 28713
242 Ga0466712_041342 3300042614 Unclassified 3456
243 Ga0466712_099633 3300042614 Unclassified 1777
244 Ga0466711_011984 3300042615 Bacteria 13320
245 Ga0466715_273981 3300042616 Bacteria 60871
246 Ga0466718_046814 3300042617 Bacteria 1095
247 Ga0466718_054183 3300042617 Bacteria 1985
248 Ga0466723_202166 3300042618 Bacteria 4296
249 Ga0466732_150363 3300042656 Bacteria 1397
250 Ga0466733_034685 3300042659 Bacteria 1840
251 Ga0264413_101799 3300024493 Bacteria 45782
252 Ga0415639_070469 3300038395 Unclassified 5014
253 Ga0466690_103850 3300042590 Bacteria 6702
254 Ga0466692_167592 3300042591 Bacteria 12428
255 Ga0466691_201379 3300042593 Bacteria 4093
256 Ga0123357_10133513 3300009784 Bacteria 3079
257 Ga0466700_091065 3300042600 Bacteria 2090
258 Ga0466717_030222 3300042604 Bacteria 4022
259 Ga0466716_222465 3300042605 Bacteria 2766
260 Ga0466716_336427 3300042605 Bacteria 3629
261 Ga0466720_026223 3300042607 Bacteria 21951
262 Ga0466720_032914 3300042607 Bacteria 6493
263 Ga0466720_122960 3300042607 Bacteria 3517
264 Ga0466698_182361 3300042610 Bacteria 1061
265 JGI24698J34947_10001479 3300002449 Bacteria 12409
266 JGI24698J34947_10076768 3300002449 Unclassified 1582
267 JGI24695J34938_10004637 3300002450 Bacteria 8931
268 JGI24703J35330_11748138 3300002501 Bacteria 11077
269 Ga0072940_1165517 3300005200 Unclassified 1826
270 Ga0466702_173052 3300042635 Bacteria 1938
271 Ga0466702_242762 3300042635 Bacteria 1988
272 Ga0466703_412706 3300042636 Bacteria 12447
273 Ga0466709_115121 3300042648 Bacteria 27961
274 Ga0466708_023735 3300042652 Bacteria 2970
275 Ga0466727_292024 3300042655 Bacteria 1544
276 Ga0466712_275790 3300042614 Bacteria 1727
277 Ga0466715_369455 3300042616 Bacteria 1893
278 Ga0466715_620634 3300042616 Bacteria 2382
279 Ga0466718_028392 3300042617 Bacteria 5907
280 Ga0466718_031952 3300042617 Unclassified 1375
281 Ga0466718_062169 3300042617 Bacteria 1631
282 Ga0466723_018641 3300042618 Bacteria 57830
283 Ga0466726_229602 3300042619 Bacteria 1816

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04298 Zn_peptidase_2 Putative neutral zinc metallopeptidase 52 252 0.98

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.