Protein Family IF09612
Metagenome
Metatranscriptome
Isolate
310
Members
85
Samples
283
Scaffolds
222.05
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_158916|Ga0466709_158916_3433_4248
- Length
- 260 aa
- Sequence
- MIVVKNLFKKMLCIGTSSARPRMAHRTGPEVKNLDRLNNPEYTAPMYLDTYYLILVVPTIFLSLWAQFTVKSAFSKYSKIRCSRGITGAAAAQILMDANNISDVRIEQVAGSLTDHYDPAHRVLRLSQPVYGEPSIAAVGVAAHETGHAIQHARGYGPLGLRSTLVPVANIGSSIGPWLALGGLVAGFPFLLTLGIILFAGAVAFYLITLPVEFNASARALAILKQNQVLDSRELAGVKKVLSAAAMTYVRLILLSRRRH
Sample Types
Isolate
8.7%
Metagenome
91.0%
MAG
0.0%
Metatranscriptome
0.3%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.2%
Unclassified
28.9%
Kalotermitidae
16.9%
Rhinotermitidae
3.6%
Termopsidae
3.6%
Calliphoridae
1.2%
Scarabaeidae
1.2%
Tenebrionidae
1.2%
Passalidae
1.2%
Taxonomy
Archaea
0
Bacteria
278
Eukaryota
0
Viruses
0
Unclassified
32
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 2 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 3 | 2820321184 | Unclassified Firmicutes Nt197P3bin86 | Isolate | Unclassified |
| 4 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 5 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 6 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 7 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 8 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 9 | 2593339124 | Clostridium sp. 4 | Isolate | Termitidae |
| 10 | 2820724199 | Unclassified Cloacimonetes Th196P3bin22 | Isolate | Unclassified |
| 11 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 12 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 13 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 14 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 15 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 16 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 17 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 18 | 2820813074 | Unclassified Actinobacteria Nt197P3bin52 | Isolate | Unclassified |
| 19 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 20 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 21 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 22 | 2820254385 | Unclassified Firmicutes Th196P3bin54 | Isolate | Unclassified |
| 23 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 24 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 25 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 26 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 27 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 28 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 29 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 30 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 31 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 32 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 33 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 34 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 35 | 2820811576 | Unclassified Actinobacteria Nt197P3bin53 | Isolate | Unclassified |
| 36 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 37 | 2634166424 | Clostridium sp. L74 | Isolate | Scarabaeidae |
| 38 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 39 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 40 | 2820350530 | Unclassified Firmicutes Nt197P3bin37 | Isolate | Unclassified |
| 41 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 42 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 43 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 44 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 45 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 46 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 47 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 48 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 49 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 50 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 51 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 52 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 53 | 2820866620 | Unclassified Actinobacteria Lab288P3bin139 | Isolate | Unclassified |
| 54 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 55 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 56 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 57 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 58 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 59 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 60 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 61 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 62 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 63 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 64 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 65 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 66 | 2820344559 | Unclassified Firmicutes Nt197P3bin63 | Isolate | Unclassified |
| 67 | 2820647881 | Unclassified Firmicutes Cu122P5bin16 | Isolate | Unclassified |
| 68 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 69 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 70 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 71 | 2820244222 | Unclassified Firmicutes Th196P3bin75 | Isolate | Unclassified |
| 72 | 2820380671 | Unclassified Firmicutes Nt197P1bin4 | Isolate | Unclassified |
| 73 | 2820607737 | Unclassified Firmicutes Emb289P1bin48 | Isolate | Unclassified |
| 74 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 75 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 76 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 77 | 3300021238 | Termite gut microbial communities from nest - French Guiana - 6_6 mRNA SA | Metatranscriptome | Termitidae |
| 78 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 79 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 80 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 81 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 82 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 83 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 84 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 85 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_413195 | 3300042656 | Unclassified | 6909 |
| 2 | Ga0264413_110358 | 3300024493 | Bacteria | 12968 |
| 3 | Ga0466690_388029 | 3300042590 | Unclassified | 1588 |
| 4 | Ga0466692_080320 | 3300042591 | Bacteria | 36899 |
| 5 | Ga0466693_077194 | 3300042592 | Bacteria | 21406 |
| 6 | Ga0466693_379155 | 3300042592 | Bacteria | 1058 |
| 7 | Ga0466691_007602 | 3300042593 | Unclassified | 1088 |
| 8 | Ga0466699_144688 | 3300042597 | Bacteria | 2300 |
| 9 | Ga0466717_030593 | 3300042604 | Unclassified | 2979 |
| 10 | Ga0466719_320130 | 3300042606 | Unclassified | 1953 |
| 11 | Ga0466719_456824 | 3300042606 | Bacteria | 13119 |
| 12 | Ga0466719_485823 | 3300042606 | Bacteria | 8981 |
| 13 | Ga0466722_036568 | 3300042609 | Bacteria | 2628 |
| 14 | Ga0466722_079405 | 3300042609 | Bacteria | 6823 |
| 15 | JGI24698J34947_10070961 | 3300002449 | Bacteria | 1674 |
| 16 | Ga0072940_1036595 | 3300005200 | Bacteria | 3801 |
| 17 | Ga0072941_1005107 | 3300005201 | Bacteria | 20281 |
| 18 | Ga0072941_1074915 | 3300005201 | Unclassified | 4060 |
| 19 | Ga0466735_219655 | 3300042624 | Bacteria | 5544 |
| 20 | Ga0466703_025704 | 3300042636 | Bacteria | 95958 |
| 21 | Ga0466704_149580 | 3300042643 | Bacteria | 17340 |
| 22 | Ga0466709_071710 | 3300042648 | Bacteria | 8781 |
| 23 | Ga0466709_163049 | 3300042648 | Bacteria | 27099 |
| 24 | Ga0466725_043503 | 3300042654 | Bacteria | 1249 |
| 25 | Ga0466712_069354 | 3300042614 | Bacteria | 2863 |
| 26 | Ga0466712_096443 | 3300042614 | Unclassified | 6056 |
| 27 | Ga0466712_109162 | 3300042614 | Bacteria | 6414 |
| 28 | Ga0466712_209275 | 3300042614 | Bacteria | 9430 |
| 29 | Ga0466715_291663 | 3300042616 | Bacteria | 2938 |
| 30 | Ga0466723_038578 | 3300042618 | Bacteria | 3149 |
| 31 | Ga0466723_121736 | 3300042618 | Bacteria | 1122 |
| 32 | Ga0223681_1005369 | 3300021238 | Bacteria | 1663 |
| 33 | Ga0415639_059218 | 3300038395 | Bacteria | 2154 |
| 34 | Ga0466690_021750 | 3300042590 | Bacteria | 10945 |
| 35 | Ga0466699_046170 | 3300042597 | Bacteria | 10961 |
| 36 | Ga0123355_10007506 | 3300009826 | Bacteria | 16354 |
| 37 | Ga0123353_10033172 | 3300010167 | Bacteria | 8034 |
| 38 | Ga0466700_396806 | 3300042600 | Bacteria | 1477 |
| 39 | Ga0466713_084750 | 3300042602 | Bacteria | 8483 |
| 40 | Ga0466721_278559 | 3300042608 | Bacteria | 1520 |
| 41 | Ga0466722_065079 | 3300042609 | Bacteria | 5282 |
| 42 | AustNasuHG_c1000367 | 3300000089 | Bacteria | 15638 |
| 43 | AustNasuHG_c1001045 | 3300000089 | Bacteria | 9962 |
| 44 | AustNasuHG_c1002136 | 3300000089 | Bacteria | 7142 |
| 45 | AustNasuHG_c1007904 | 3300000089 | Bacteria | 3771 |
| 46 | JGI24698J34947_10011714 | 3300002449 | Bacteria | 4816 |
| 47 | JGI24698J34947_10028976 | 3300002449 | Bacteria | 2929 |
| 48 | JGI24702J35022_10002023 | 3300002462 | Bacteria | 12494 |
| 49 | Ga0072940_1022677 | 3300005200 | Bacteria | 29727 |
| 50 | Ga0072941_1004651 | 3300005201 | Bacteria | 14259 |
| 51 | Ga0072941_1023296 | 3300005201 | Bacteria | 1389 |
| 52 | Ga0072941_1041651 | 3300005201 | Bacteria | 7686 |
| 53 | Ga0072941_1110148 | 3300005201 | Bacteria | 5652 |
| 54 | Ga0466735_023146 | 3300042624 | Bacteria | 10947 |
| 55 | Ga0466702_325681 | 3300042635 | Bacteria | 1276 |
| 56 | Ga0466703_174554 | 3300042636 | Bacteria | 29909 |
| 57 | Ga0466704_396270 | 3300042643 | Bacteria | 41737 |
| 58 | Ga0466727_181644 | 3300042655 | Bacteria | 1683 |
| 59 | Ga0466712_018664 | 3300042614 | Bacteria | 4783 |
| 60 | Ga0466712_112979 | 3300042614 | Bacteria | 2831 |
| 61 | Ga0466712_123454 | 3300042614 | Unclassified | 2807 |
| 62 | Ga0466712_210387 | 3300042614 | Bacteria | 3403 |
| 63 | Ga0466711_068019 | 3300042615 | Bacteria | 10252 |
| 64 | Ga0466711_483637 | 3300042615 | Bacteria | 1076 |
| 65 | Ga0466715_135735 | 3300042616 | Bacteria | 9043 |
| 66 | Ga0466715_344593 | 3300042616 | Unclassified | 2846 |
| 67 | Ga0466715_523174 | 3300042616 | Bacteria | 1308 |
| 68 | Ga0466715_529016 | 3300042616 | Bacteria | 3741 |
| 69 | Ga0466718_086156 | 3300042617 | Bacteria | 4707 |
| 70 | Ga0466718_100233 | 3300042617 | Bacteria | 3720 |
| 71 | Ga0466723_232679 | 3300042618 | Bacteria | 4221 |
| 72 | Ga0466726_276820 | 3300042619 | Bacteria | 3600 |
| 73 | Ga0466726_420195 | 3300042619 | Bacteria | 2254 |
| 74 | Ga0466727_350630 | 3300042655 | Bacteria | 1237 |
| 75 | Ga0466732_455816 | 3300042656 | Bacteria | 1438 |
| 76 | Ga0466692_019543 | 3300042591 | Bacteria | 1101 |
| 77 | Ga0466699_141604 | 3300042597 | Bacteria | 3964 |
| 78 | Ga0466699_353824 | 3300042597 | Bacteria | 3407 |
| 79 | Ga0466699_442349 | 3300042597 | Bacteria | 14365 |
| 80 | Ga0123353_10146324 | 3300010167 | Bacteria | 3777 |
| 81 | Ga0466701_037826 | 3300042598 | Bacteria | 1025 |
| 82 | Ga0466700_353947 | 3300042600 | Bacteria | 1057 |
| 83 | Ga0466716_275640 | 3300042605 | Bacteria | 10726 |
| 84 | Ga0466720_034169 | 3300042607 | Bacteria | 1695 |
| 85 | Ga0466720_075940 | 3300042607 | Bacteria | 13266 |
| 86 | Ga0466720_114834 | 3300042607 | Bacteria | 2588 |
| 87 | Ga0466720_186762 | 3300042607 | Bacteria | 15310 |
| 88 | Ga0466722_021973 | 3300042609 | Bacteria | 8920 |
| 89 | Ga0466722_023053 | 3300042609 | Bacteria | 2465 |
| 90 | Ga0466698_240595 | 3300042610 | Bacteria | 1152 |
| 91 | JGI24698J34947_10003654 | 3300002449 | Unclassified | 8353 |
| 92 | JGI24698J34947_10011109 | 3300002449 | Bacteria | 4942 |
| 93 | JGI24695J34938_10000485 | 3300002450 | Unclassified | 38557 |
| 94 | JGI24702J35022_10030198 | 3300002462 | Bacteria | 2908 |
| 95 | Ga0072940_1165518 | 3300005200 | Bacteria | 1421 |
| 96 | Ga0072941_1037637 | 3300005201 | Bacteria | 7295 |
| 97 | Ga0466731_164426 | 3300042622 | Bacteria | 14856 |
| 98 | Ga0466731_301131 | 3300042622 | Bacteria | 3851 |
| 99 | Ga0466731_317654 | 3300042622 | Bacteria | 1176 |
| 100 | Ga0466735_044238 | 3300042624 | Bacteria | 1736 |
| 101 | Ga0466703_109340 | 3300042636 | Bacteria | 9695 |
| 102 | Ga0466703_141846 | 3300042636 | Bacteria | 4062 |
| 103 | Ga0466703_192353 | 3300042636 | Bacteria | 6084 |
| 104 | Ga0466703_257935 | 3300042636 | Bacteria | 1613 |
| 105 | Ga0466709_158916 | 3300042648 | Bacteria | 35318 |
| 106 | Ga0466709_401872 | 3300042648 | Bacteria | 1390 |
| 107 | Ga0466727_313517 | 3300042655 | Bacteria | 1896 |
| 108 | Ga0466712_010094 | 3300042614 | Bacteria | 5748 |
| 109 | Ga0466712_042192 | 3300042614 | Unclassified | 3739 |
| 110 | Ga0466712_067097 | 3300042614 | Unclassified | 2218 |
| 111 | Ga0466712_120077 | 3300042614 | Bacteria | 8532 |
| 112 | Ga0466718_033907 | 3300042617 | Bacteria | 28713 |
| 113 | Ga0466723_088666 | 3300042618 | Unclassified | 1875 |
| 114 | Ga0466705_227110 | 3300042612 | Bacteria | 9868 |
| 115 | Ga0466693_249702 | 3300042592 | Bacteria | 3239 |
| 116 | Ga0466695_221990 | 3300042595 | Bacteria | 77793 |
| 117 | Ga0466699_208758 | 3300042597 | Bacteria | 1134 |
| 118 | Ga0466699_360871 | 3300042597 | Bacteria | 1697 |
| 119 | Ga0123355_10004597 | 3300009826 | Bacteria | 20065 |
| 120 | Ga0123353_10317344 | 3300010167 | Bacteria | 2367 |
| 121 | Ga0123353_10356407 | 3300010167 | Bacteria | 2201 |
| 122 | Ga0466700_091937 | 3300042600 | Bacteria | 2316 |
| 123 | Ga0466717_035249 | 3300042604 | Bacteria | 1811 |
| 124 | Ga0466719_199985 | 3300042606 | Bacteria | 3184 |
| 125 | Ga0466720_039852 | 3300042607 | Bacteria | 3307 |
| 126 | Ga0466722_188485 | 3300042609 | Bacteria | 26025 |
| 127 | AustNasuHG_c1002579 | 3300000089 | Bacteria | 6542 |
| 128 | AustNasuHG_c1013831 | 3300000089 | Bacteria | 2758 |
| 129 | JGI24698J34947_10022980 | 3300002449 | Bacteria | 3338 |
| 130 | JGI24698J34947_10040413 | 3300002449 | Bacteria | 2408 |
| 131 | JGI24695J34938_10000403 | 3300002450 | Bacteria | 42148 |
| 132 | Ga0072941_1008723 | 3300005201 | Bacteria | 6351 |
| 133 | Ga0466704_317418 | 3300042643 | Unclassified | 2777 |
| 134 | Ga0466708_321737 | 3300042652 | Bacteria | 61371 |
| 135 | Ga0466708_389577 | 3300042652 | Bacteria | 54586 |
| 136 | Ga0466725_173280 | 3300042654 | Bacteria | 4521 |
| 137 | Ga0466712_038490 | 3300042614 | Bacteria | 2845 |
| 138 | Ga0466711_284745 | 3300042615 | Bacteria | 2182 |
| 139 | Ga0466715_032569 | 3300042616 | Bacteria | 9902 |
| 140 | Ga0466715_110852 | 3300042616 | Bacteria | 6336 |
| 141 | Ga0466718_067678 | 3300042617 | Bacteria | 1154 |
| 142 | Ga0466723_021073 | 3300042618 | Bacteria | 30395 |
| 143 | Ga0466723_324785 | 3300042618 | Bacteria | 11375 |
| 144 | Ga0466726_081873 | 3300042619 | Bacteria | 5558 |
| 145 | Ga0466726_267542 | 3300042619 | Bacteria | 5329 |
| 146 | Ga0466705_147961 | 3300042612 | Bacteria | 3649 |
| 147 | Ga0415639_010949 | 3300038395 | Bacteria | 19628 |
| 148 | Ga0466692_094488 | 3300042591 | Unclassified | 1030 |
| 149 | Ga0466694_398198 | 3300042594 | Bacteria | 2204 |
| 150 | Ga0466696_346398 | 3300042596 | Bacteria | 18868 |
| 151 | Ga0466699_012397 | 3300042597 | Bacteria | 1564 |
| 152 | Ga0466699_091474 | 3300042597 | Bacteria | 2294 |
| 153 | Ga0466699_119345 | 3300042597 | Bacteria | 2485 |
| 154 | Ga0466699_198257 | 3300042597 | Bacteria | 6049 |
| 155 | Ga0123353_10261794 | 3300010167 | Bacteria | 2671 |
| 156 | Ga0123353_10700397 | 3300010167 | Bacteria | 1422 |
| 157 | Ga0466716_423240 | 3300042605 | Bacteria | 4584 |
| 158 | Ga0466719_356933 | 3300042606 | Bacteria | 21887 |
| 159 | Ga0466719_387698 | 3300042606 | Bacteria | 10621 |
| 160 | Ga0466720_168636 | 3300042607 | Bacteria | 1004 |
| 161 | JGI24698J34947_10012342 | 3300002449 | Unclassified | 4682 |
| 162 | JGI24698J34947_10013962 | 3300002449 | Bacteria | 4377 |
| 163 | JGI24698J34947_10015366 | 3300002449 | Bacteria | 4168 |
| 164 | JGI24698J34947_10021840 | 3300002449 | Unclassified | 3439 |
| 165 | JGI24695J34938_10004341 | 3300002450 | Bacteria | 9337 |
| 166 | JGI24695J34938_10015732 | 3300002450 | Bacteria | 3872 |
| 167 | JGI24699J35502_11133733 | 3300002509 | Bacteria | 14455 |
| 168 | Ga0072941_1065721 | 3300005201 | Bacteria | 4253 |
| 169 | Ga0466705_404410 | 3300042612 | Bacteria | 1193 |
| 170 | Ga0466715_062239 | 3300042616 | Bacteria | 9585 |
| 171 | Ga0466715_496464 | 3300042616 | Bacteria | 6437 |
| 172 | Ga0466718_074471 | 3300042617 | Unclassified | 1588 |
| 173 | Ga0466718_075327 | 3300042617 | Bacteria | 8975 |
| 174 | Ga0466728_078526 | 3300042620 | Bacteria | 1983 |
| 175 | Ga0466732_310043 | 3300042656 | Bacteria | 9300 |
| 176 | Ga0466732_409936 | 3300042656 | Bacteria | 1731 |
| 177 | Ga0562377_0006 | 3300056842 | Bacteria | 3350072 |
| 178 | Ga0466692_001596 | 3300042591 | Bacteria | 5390 |
| 179 | Ga0466691_165191 | 3300042593 | Bacteria | 3959 |
| 180 | Ga0466696_041825 | 3300042596 | Bacteria | 1423 |
| 181 | Ga0466696_342530 | 3300042596 | Bacteria | 1318 |
| 182 | Ga0466699_030715 | 3300042597 | Bacteria | 8240 |
| 183 | Ga0466699_051177 | 3300042597 | Bacteria | 5398 |
| 184 | Ga0466699_122834 | 3300042597 | Bacteria | 2000 |
| 185 | Ga0466699_374435 | 3300042597 | Bacteria | 5818 |
| 186 | Ga0123357_10301745 | 3300009784 | Bacteria | 1616 |
| 187 | Ga0466700_301349 | 3300042600 | Bacteria | 2407 |
| 188 | Ga0466717_031667 | 3300042604 | Unclassified | 4662 |
| 189 | Ga0466716_227546 | 3300042605 | Bacteria | 7896 |
| 190 | Ga0466719_219551 | 3300042606 | Bacteria | 10831 |
| 191 | Ga0466720_020438 | 3300042607 | Bacteria | 42880 |
| 192 | Ga0466720_088992 | 3300042607 | Bacteria | 4181 |
| 193 | Ga0466722_075956 | 3300042609 | Bacteria | 5792 |
| 194 | Ga0466722_152320 | 3300042609 | Bacteria | 3368 |
| 195 | JGI24702J35022_10150273 | 3300002462 | Bacteria | 1306 |
| 196 | Ga0072940_1096145 | 3300005200 | Bacteria | 4183 |
| 197 | Ga0072941_1041625 | 3300005201 | Bacteria | 3037 |
| 198 | Ga0466731_287683 | 3300042622 | Bacteria | 2417 |
| 199 | Ga0466703_344664 | 3300042636 | Bacteria | 5045 |
| 200 | Ga0466709_061723 | 3300042648 | Bacteria | 3566 |
| 201 | Ga0466712_132603 | 3300042614 | Unclassified | 3239 |
| 202 | Ga0466712_138285 | 3300042614 | Unclassified | 7450 |
| 203 | Ga0466711_032090 | 3300042615 | Bacteria | 5872 |
| 204 | Ga0466718_063157 | 3300042617 | Bacteria | 1959 |
| 205 | Ga0466718_083006 | 3300042617 | Bacteria | 2181 |
| 206 | Ga0466723_065796 | 3300042618 | Bacteria | 3291 |
| 207 | Ga0466728_206531 | 3300042620 | Bacteria | 1551 |
| 208 | Ga0466728_296707 | 3300042620 | Bacteria | 18805 |
| 209 | Ga0466692_171787 | 3300042591 | Bacteria | 1010 |
| 210 | Ga0466691_083549 | 3300042593 | Bacteria | 6036 |
| 211 | Ga0466691_217709 | 3300042593 | Bacteria | 28640 |
| 212 | Ga0466699_378658 | 3300042597 | Bacteria | 8679 |
| 213 | Ga0123356_10041491 | 3300010049 | Bacteria | 4287 |
| 214 | Ga0123353_11078385 | 3300010167 | Bacteria | 1069 |
| 215 | Ga0123354_10374145 | 3300010882 | Bacteria | 1239 |
| 216 | Ga0466707_005890 | 3300042601 | Bacteria | 5692 |
| 217 | Ga0466719_234209 | 3300042606 | Unclassified | 1911 |
| 218 | Ga0466719_418804 | 3300042606 | Bacteria | 1627 |
| 219 | Ga0466719_554039 | 3300042606 | Unclassified | 3024 |
| 220 | Ga0466720_006235 | 3300042607 | Bacteria | 3238 |
| 221 | Ga0466720_213686 | 3300042607 | Bacteria | 2153 |
| 222 | Ga0466722_014246 | 3300042609 | Bacteria | 18174 |
| 223 | Ga0466722_052243 | 3300042609 | Bacteria | 23183 |
| 224 | IMNBL1DRAFT_c0028955 | 3300000062 | Bacteria | 2057 |
| 225 | JGI24698J34947_10019077 | 3300002449 | Bacteria | 3703 |
| 226 | JGI24698J34947_10020510 | 3300002449 | Bacteria | 3558 |
| 227 | JGI24698J34947_10097875 | 3300002449 | Bacteria | 1327 |
| 228 | JGI24698J34947_10121988 | 3300002449 | Bacteria | 1129 |
| 229 | JGI24695J34938_10005364 | 3300002450 | Bacteria | 8014 |
| 230 | JGI24695J34938_10056672 | 3300002450 | Unclassified | 1688 |
| 231 | JGI24697J35500_11016921 | 3300002507 | Unclassified | 973 |
| 232 | Ga0072940_1033290 | 3300005200 | Bacteria | 1551 |
| 233 | Ga0072941_1107128 | 3300005201 | Bacteria | 3480 |
| 234 | Ga0072941_1109416 | 3300005201 | Bacteria | 4767 |
| 235 | Ga0466729_223148 | 3300042621 | Bacteria | 1012 |
| 236 | Ga0466735_066425 | 3300042624 | Bacteria | 33205 |
| 237 | Ga0466704_094999 | 3300042643 | Bacteria | 61949 |
| 238 | Ga0466708_369999 | 3300042652 | Bacteria | 3308 |
| 239 | Ga0466708_417592 | 3300042652 | Bacteria | 3671 |
| 240 | Ga0466712_024591 | 3300042614 | Bacteria | 1553 |
| 241 | Ga0466712_033366 | 3300042614 | Bacteria | 28713 |
| 242 | Ga0466712_041342 | 3300042614 | Unclassified | 3456 |
| 243 | Ga0466712_099633 | 3300042614 | Unclassified | 1777 |
| 244 | Ga0466711_011984 | 3300042615 | Bacteria | 13320 |
| 245 | Ga0466715_273981 | 3300042616 | Bacteria | 60871 |
| 246 | Ga0466718_046814 | 3300042617 | Bacteria | 1095 |
| 247 | Ga0466718_054183 | 3300042617 | Bacteria | 1985 |
| 248 | Ga0466723_202166 | 3300042618 | Bacteria | 4296 |
| 249 | Ga0466732_150363 | 3300042656 | Bacteria | 1397 |
| 250 | Ga0466733_034685 | 3300042659 | Bacteria | 1840 |
| 251 | Ga0264413_101799 | 3300024493 | Bacteria | 45782 |
| 252 | Ga0415639_070469 | 3300038395 | Unclassified | 5014 |
| 253 | Ga0466690_103850 | 3300042590 | Bacteria | 6702 |
| 254 | Ga0466692_167592 | 3300042591 | Bacteria | 12428 |
| 255 | Ga0466691_201379 | 3300042593 | Bacteria | 4093 |
| 256 | Ga0123357_10133513 | 3300009784 | Bacteria | 3079 |
| 257 | Ga0466700_091065 | 3300042600 | Bacteria | 2090 |
| 258 | Ga0466717_030222 | 3300042604 | Bacteria | 4022 |
| 259 | Ga0466716_222465 | 3300042605 | Bacteria | 2766 |
| 260 | Ga0466716_336427 | 3300042605 | Bacteria | 3629 |
| 261 | Ga0466720_026223 | 3300042607 | Bacteria | 21951 |
| 262 | Ga0466720_032914 | 3300042607 | Bacteria | 6493 |
| 263 | Ga0466720_122960 | 3300042607 | Bacteria | 3517 |
| 264 | Ga0466698_182361 | 3300042610 | Bacteria | 1061 |
| 265 | JGI24698J34947_10001479 | 3300002449 | Bacteria | 12409 |
| 266 | JGI24698J34947_10076768 | 3300002449 | Unclassified | 1582 |
| 267 | JGI24695J34938_10004637 | 3300002450 | Bacteria | 8931 |
| 268 | JGI24703J35330_11748138 | 3300002501 | Bacteria | 11077 |
| 269 | Ga0072940_1165517 | 3300005200 | Unclassified | 1826 |
| 270 | Ga0466702_173052 | 3300042635 | Bacteria | 1938 |
| 271 | Ga0466702_242762 | 3300042635 | Bacteria | 1988 |
| 272 | Ga0466703_412706 | 3300042636 | Bacteria | 12447 |
| 273 | Ga0466709_115121 | 3300042648 | Bacteria | 27961 |
| 274 | Ga0466708_023735 | 3300042652 | Bacteria | 2970 |
| 275 | Ga0466727_292024 | 3300042655 | Bacteria | 1544 |
| 276 | Ga0466712_275790 | 3300042614 | Bacteria | 1727 |
| 277 | Ga0466715_369455 | 3300042616 | Bacteria | 1893 |
| 278 | Ga0466715_620634 | 3300042616 | Bacteria | 2382 |
| 279 | Ga0466718_028392 | 3300042617 | Bacteria | 5907 |
| 280 | Ga0466718_031952 | 3300042617 | Unclassified | 1375 |
| 281 | Ga0466718_062169 | 3300042617 | Bacteria | 1631 |
| 282 | Ga0466723_018641 | 3300042618 | Bacteria | 57830 |
| 283 | Ga0466726_229602 | 3300042619 | Bacteria | 1816 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04298 | Zn_peptidase_2 | Putative neutral zinc metallopeptidase | 52 | 252 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.