Protein Family IF09557
Metagenome
Isolate
207
Members
77
Samples
185
Scaffolds
230.36
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_026774|Ga0466709_026774_210_1019
- Length
- 269 aa
- Sequence
- MGNGVLPVLTGEPLGKPMTSAAVCGGSVGFLIWGVDRMYSAEIEHMCVVAKGAYHGPAPVPEEGKWVQVKENGDISGLTHGVGWCAPQQGACKLTLNVKNGIIEEALIETIGCSGMTHSAAMAAEILQGKTLIEALNTDLVCDAINVAMRELFLQIVYGRSQTAFSEGGLPIGAGLEDLGGSLRSQIGTMYGTKAKGARYLEMAEGYVTRLALDKDNLIIGYEFVNMGKMMAAIKKGIDANDALKSSSGHYGRFTEADGAVKYIDPRKE
Sample Types
Isolate
10.6%
Metagenome
89.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.3%
Unclassified
26.7%
Kalotermitidae
18.7%
Termopsidae
5.3%
Blattidae
4.0%
Rhinotermitidae
4.0%
Passalidae
2.7%
Hodotermitidae
1.3%
Taxonomy
Archaea
0
Bacteria
188
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 2 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 3 | 2820211246 | Unclassified Kiritimatiellaeota Nt197P3bin96 | Isolate | Unclassified |
| 4 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 5 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 6 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 7 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 8 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 9 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 13 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 14 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 2740892547 | Fibrobacteria bacterium GUT77 MC_77 | Isolate | Unclassified |
| 17 | 2820209022 | Unclassified Kiritimatiellaeota Th196P3bin76 | Isolate | Unclassified |
| 18 | 2820412446 | Unclassified Firmicutes Lab288P4bin39 | Isolate | Unclassified |
| 19 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 20 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 21 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 22 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 23 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 24 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 25 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 26 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 27 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 28 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 29 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 30 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 31 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 32 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 33 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 34 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 35 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 36 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 37 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 38 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 39 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 40 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 41 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 42 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 43 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 44 | 2820007728 | Unclassified Synergistetes Lab288P3bin114 | Isolate | Unclassified |
| 45 | 2820215626 | Unclassified Kiritimatiellaeota Nt197P3bin123 | Isolate | Unclassified |
| 46 | 2820044805 | Unclassified Proteobacteria Th196P4bin15 | Isolate | Unclassified |
| 47 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 48 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 49 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 50 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 51 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 52 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 53 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 54 | 2820357977 | Unclassified Firmicutes Nt197P3bin136 | Isolate | Unclassified |
| 55 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 56 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 57 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 58 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 59 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 60 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 61 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 62 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 63 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 64 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 65 | 2820001644 | Unclassified Synergistetes Th196P3bin106 | Isolate | Unclassified |
| 66 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 67 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 68 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 69 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 70 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 71 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 72 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 73 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 74 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 75 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 76 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 77 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466727_349859 | 3300042655 | Unclassified | 1071 |
| 2 | Ga0466692_097561 | 3300042591 | Bacteria | 53967 |
| 3 | Ga0466692_168144 | 3300042591 | Bacteria | 8010 |
| 4 | Ga0466694_082023 | 3300042594 | Bacteria | 1488 |
| 5 | Ga0466726_413471 | 3300042619 | Bacteria | 5388 |
| 6 | Ga0466707_252337 | 3300042601 | Bacteria | 19824 |
| 7 | Ga0466713_013389 | 3300042602 | Bacteria | 5006 |
| 8 | Ga0466716_272319 | 3300042605 | Bacteria | 3863 |
| 9 | Ga0466721_285597 | 3300042608 | Bacteria | 2500 |
| 10 | Ga0466698_421500 | 3300042610 | Bacteria | 1218 |
| 11 | Ga0466698_453437 | 3300042610 | Bacteria | 1280 |
| 12 | Ga0123357_10237198 | 3300009784 | Bacteria | 1984 |
| 13 | Ga0123356_10187739 | 3300010049 | Bacteria | 2095 |
| 14 | Ga0123356_10611759 | 3300010049 | Bacteria | 1255 |
| 15 | Ga0123356_10800459 | 3300010049 | Bacteria | 1113 |
| 16 | Ga0123353_10014647 | 3300010167 | Bacteria | 11319 |
| 17 | Ga0123353_11121745 | 3300010167 | Bacteria | 1042 |
| 18 | Ga0466704_457394 | 3300042643 | Unclassified | 2690 |
| 19 | Ga0466708_282915 | 3300042652 | Bacteria | 14159 |
| 20 | Ga0466727_035395 | 3300042655 | Bacteria | 1565 |
| 21 | Ga0466727_302838 | 3300042655 | Unclassified | 1230 |
| 22 | Ga0466727_317733 | 3300042655 | Bacteria | 2894 |
| 23 | Nasutiter_Contig16724 | 2030936001 | Bacteria | 1182 |
| 24 | JGI24702J35022_10004580 | 3300002462 | Bacteria | 8199 |
| 25 | JGI24702J35022_10136621 | 3300002462 | Bacteria | 1365 |
| 26 | Ga0264413_122069 | 3300024493 | Bacteria | 11894 |
| 27 | Ga0466691_026137 | 3300042593 | Unclassified | 6264 |
| 28 | Ga0466712_234008 | 3300042614 | Bacteria | 1977 |
| 29 | Ga0466715_001151 | 3300042616 | Bacteria | 10830 |
| 30 | Ga0466714_011689 | 3300042603 | Bacteria | 41248 |
| 31 | Ga0466719_083211 | 3300042606 | Bacteria | 2894 |
| 32 | Ga0123357_10661808 | 3300009784 | Bacteria | 767 |
| 33 | Ga0123356_10073023 | 3300010049 | Bacteria | 3225 |
| 34 | Ga0123356_10867161 | 3300010049 | Bacteria | 1074 |
| 35 | Ga0123356_10902221 | 3300010049 | Bacteria | 1055 |
| 36 | Ga0123353_10043922 | 3300010167 | Bacteria | 7082 |
| 37 | Ga0123353_10324004 | 3300010167 | Bacteria | 2337 |
| 38 | Ga0123353_10870865 | 3300010167 | Bacteria | 1231 |
| 39 | Ga0466729_266214 | 3300042621 | Bacteria | 68016 |
| 40 | Ga0466735_011609 | 3300042624 | Bacteria | 1447 |
| 41 | Ga0466735_189863 | 3300042624 | Bacteria | 1822 |
| 42 | Ga0466703_214791 | 3300042636 | Bacteria | 4491 |
| 43 | Ga0466704_252044 | 3300042643 | Bacteria | 4479 |
| 44 | Ga0466709_026774 | 3300042648 | Bacteria | 5285 |
| 45 | Ga0466727_122834 | 3300042655 | Bacteria | 3488 |
| 46 | Ga0466727_343331 | 3300042655 | Bacteria | 2164 |
| 47 | AustNasuHG_c1004179 | 3300000089 | Bacteria | 5190 |
| 48 | Ga0068302_10040336 | 3300005071 | Bacteria | 15583 |
| 49 | Ga0466697_129394 | 3300042611 | Bacteria | 1130 |
| 50 | Ga0466705_006684 | 3300042612 | Bacteria | 2046 |
| 51 | Ga0466699_188267 | 3300042597 | Bacteria | 2948 |
| 52 | Ga0466715_018828 | 3300042616 | Bacteria | 12645 |
| 53 | Ga0466715_466052 | 3300042616 | Bacteria | 1766 |
| 54 | Ga0466728_162625 | 3300042620 | Bacteria | 3822 |
| 55 | Ga0466706_075947 | 3300042599 | Bacteria | 1343 |
| 56 | Ga0466706_133216 | 3300042599 | Bacteria | 10131 |
| 57 | Ga0466719_353782 | 3300042606 | Unclassified | 1130 |
| 58 | Ga0123357_10038466 | 3300009784 | Bacteria | 6514 |
| 59 | Ga0123353_10179296 | 3300010167 | Bacteria | 3356 |
| 60 | Ga0123353_10294188 | 3300010167 | Bacteria | 2483 |
| 61 | Ga0466729_298027 | 3300042621 | Bacteria | 7436 |
| 62 | Ga0466731_153018 | 3300042622 | Bacteria | 1751 |
| 63 | Ga0466735_072733 | 3300042624 | Bacteria | 2082 |
| 64 | Ga0466735_188098 | 3300042624 | Unclassified | 1991 |
| 65 | Ga0466735_208290 | 3300042624 | Bacteria | 4635 |
| 66 | Ga0466703_062258 | 3300042636 | Bacteria | 16640 |
| 67 | Ga0466709_166642 | 3300042648 | Bacteria | 2890 |
| 68 | Ga0466724_30294 | 3300042649 | Bacteria | 2934 |
| 69 | Ga0466708_301714 | 3300042652 | Bacteria | 2945 |
| 70 | Ga0466727_145543 | 3300042655 | Unclassified | 1705 |
| 71 | Ga0072941_1004007 | 3300005201 | Bacteria | 37001 |
| 72 | Ga0072941_1016622 | 3300005201 | Bacteria | 1963 |
| 73 | Ga0466692_033982 | 3300042591 | Bacteria | 1175 |
| 74 | Ga0466693_267555 | 3300042592 | Unclassified | 1663 |
| 75 | Ga0466696_365074 | 3300042596 | Bacteria | 2884 |
| 76 | Ga0466705_422882 | 3300042612 | Unclassified | 1316 |
| 77 | Ga0466705_504428 | 3300042612 | Bacteria | 3292 |
| 78 | Ga0466712_016163 | 3300042614 | Bacteria | 2714 |
| 79 | Ga0466712_187039 | 3300042614 | Bacteria | 13572 |
| 80 | Ga0466706_147616 | 3300042599 | Bacteria | 3046 |
| 81 | Ga0466707_009194 | 3300042601 | Bacteria | 11194 |
| 82 | Ga0466707_051106 | 3300042601 | Bacteria | 3696 |
| 83 | Ga0466707_197521 | 3300042601 | Bacteria | 4438 |
| 84 | Ga0466714_140401 | 3300042603 | Bacteria | 1329 |
| 85 | Ga0466714_141473 | 3300042603 | Bacteria | 59209 |
| 86 | Ga0466719_541623 | 3300042606 | Bacteria | 2336 |
| 87 | Ga0466720_150015 | 3300042607 | Bacteria | 24917 |
| 88 | Ga0123354_10459872 | 3300010882 | Bacteria | 1023 |
| 89 | Ga0466708_088051 | 3300042652 | Bacteria | 36758 |
| 90 | Ga0466727_284870 | 3300042655 | Unclassified | 2618 |
| 91 | Ga0466727_321802 | 3300042655 | Bacteria | 4845 |
| 92 | 2227289989 | 2225789004 | Bacteria | 1242 |
| 93 | AustNasuHG_c1000806 | 3300000089 | Bacteria | 11240 |
| 94 | JGI24702J35022_10011274 | 3300002462 | Bacteria | 4984 |
| 95 | Ga0072941_1016621 | 3300005201 | Bacteria | 3383 |
| 96 | Ga0466705_244644 | 3300042612 | Unclassified | 1176 |
| 97 | Ga0466705_357180 | 3300042612 | Bacteria | 1569 |
| 98 | Ga0466705_358529 | 3300042612 | Bacteria | 6674 |
| 99 | Ga0466693_106972 | 3300042592 | Bacteria | 1519 |
| 100 | Ga0466691_007209 | 3300042593 | Bacteria | 1242 |
| 101 | Ga0466696_362103 | 3300042596 | Bacteria | 1517 |
| 102 | Ga0466710_091057 | 3300042613 | Bacteria | 1149 |
| 103 | Ga0466726_128587 | 3300042619 | Bacteria | 12711 |
| 104 | Ga0466726_209537 | 3300042619 | Bacteria | 1894 |
| 105 | Ga0466726_315074 | 3300042619 | Bacteria | 2224 |
| 106 | Ga0466726_321841 | 3300042619 | Bacteria | 25117 |
| 107 | Ga0466713_114885 | 3300042602 | Bacteria | 24347 |
| 108 | Ga0466714_032413 | 3300042603 | Bacteria | 17943 |
| 109 | Ga0466719_479846 | 3300042606 | Bacteria | 2388 |
| 110 | Ga0466722_023576 | 3300042609 | Bacteria | 3553 |
| 111 | Ga0466735_014248 | 3300042624 | Unclassified | 4331 |
| 112 | Ga0466735_198713 | 3300042624 | Bacteria | 1345 |
| 113 | Ga0466703_331515 | 3300042636 | Bacteria | 4192 |
| 114 | Ga0466727_174727 | 3300042655 | Bacteria | 2165 |
| 115 | IMNBL1DRAFT_c0000639 | 3300000062 | Bacteria | 28033 |
| 116 | Ga0466733_145421 | 3300042659 | Bacteria | 2289 |
| 117 | Ga0466711_376431 | 3300042615 | Bacteria | 48940 |
| 118 | Ga0466715_119601 | 3300042616 | Unclassified | 4360 |
| 119 | Ga0466718_110244 | 3300042617 | Bacteria | 2114 |
| 120 | Ga0466723_203988 | 3300042618 | Bacteria | 2174 |
| 121 | Ga0466726_025306 | 3300042619 | Bacteria | 8410 |
| 122 | Ga0466706_211464 | 3300042599 | Unclassified | 6640 |
| 123 | Ga0466706_260242 | 3300042599 | Bacteria | 4909 |
| 124 | Ga0466707_177041 | 3300042601 | Bacteria | 6870 |
| 125 | Ga0466707_357269 | 3300042601 | Unclassified | 3058 |
| 126 | Ga0466713_100108 | 3300042602 | Bacteria | 8290 |
| 127 | Ga0466717_158828 | 3300042604 | Bacteria | 1269 |
| 128 | Ga0123357_10581943 | 3300009784 | Bacteria | 871 |
| 129 | Ga0123353_10317576 | 3300010167 | Unclassified | 2366 |
| 130 | Ga0123353_10351856 | 3300010167 | Bacteria | 2219 |
| 131 | Ga0123353_10887308 | 3300010167 | Bacteria | 1216 |
| 132 | Ga0466731_256925 | 3300042622 | Bacteria | 2322 |
| 133 | Ga0466734_081512 | 3300042623 | Bacteria | 1672 |
| 134 | Ga0466735_065887 | 3300042624 | Bacteria | 1044 |
| 135 | Ga0466702_431578 | 3300042635 | Bacteria | 1304 |
| 136 | Ga0466704_068859 | 3300042643 | Unclassified | 5716 |
| 137 | JGI24698J34947_10057131 | 3300002449 | Bacteria | 1937 |
| 138 | JGI24702J35022_10043948 | 3300002462 | Bacteria | 2380 |
| 139 | Ga0415639_088166 | 3300038395 | Bacteria | 1282 |
| 140 | Ga0466690_246245 | 3300042590 | Bacteria | 1438 |
| 141 | Ga0466696_170163 | 3300042596 | Bacteria | 2694 |
| 142 | Ga0466715_568039 | 3300042616 | Bacteria | 3454 |
| 143 | Ga0466726_413375 | 3300042619 | Bacteria | 1157 |
| 144 | Ga0466728_255535 | 3300042620 | Bacteria | 3161 |
| 145 | Ga0466707_280907 | 3300042601 | Bacteria | 2267 |
| 146 | Ga0466707_400679 | 3300042601 | Bacteria | 3544 |
| 147 | Ga0466707_405512 | 3300042601 | Bacteria | 1445 |
| 148 | Ga0466720_015515 | 3300042607 | Bacteria | 13320 |
| 149 | Ga0466720_100020 | 3300042607 | Bacteria | 31760 |
| 150 | Ga0466722_064425 | 3300042609 | Bacteria | 50073 |
| 151 | Ga0466722_121337 | 3300042609 | Bacteria | 64639 |
| 152 | Ga0123353_10020281 | 3300010167 | Bacteria | 9922 |
| 153 | Ga0123354_10013040 | 3300010882 | Bacteria | 12874 |
| 154 | Ga0466731_094150 | 3300042622 | Bacteria | 14819 |
| 155 | Ga0466734_136644 | 3300042623 | Bacteria | 2310 |
| 156 | Ga0466735_043479 | 3300042624 | Bacteria | 1348 |
| 157 | Ga0466735_163031 | 3300042624 | Bacteria | 2835 |
| 158 | Ga0466703_232610 | 3300042636 | Bacteria | 1101 |
| 159 | Ga0466704_038953 | 3300042643 | Bacteria | 1650 |
| 160 | Ga0072941_1269176 | 3300005201 | Bacteria | 1703 |
| 161 | Ga0466692_037403 | 3300042591 | Bacteria | 10167 |
| 162 | Ga0466694_082521 | 3300042594 | Bacteria | 1067 |
| 163 | Ga0466696_460737 | 3300042596 | Bacteria | 5297 |
| 164 | Ga0466710_186610 | 3300042613 | Bacteria | 1387 |
| 165 | Ga0466715_024662 | 3300042616 | Bacteria | 23560 |
| 166 | Ga0466726_301839 | 3300042619 | Bacteria | 1981 |
| 167 | Ga0466728_192774 | 3300042620 | Bacteria | 2170 |
| 168 | Ga0466729_167110 | 3300042621 | Bacteria | 6450 |
| 169 | Ga0466701_081324 | 3300042598 | Bacteria | 1057 |
| 170 | Ga0466701_099047 | 3300042598 | Bacteria | 3735 |
| 171 | Ga0466706_219638 | 3300042599 | Bacteria | 29525 |
| 172 | Ga0466707_213815 | 3300042601 | Bacteria | 28177 |
| 173 | Ga0466698_480019 | 3300042610 | Bacteria | 1633 |
| 174 | Ga0466729_206008 | 3300042621 | Bacteria | 4714 |
| 175 | Ga0466735_020891 | 3300042624 | Unclassified | 1059 |
| 176 | Ga0466702_457741 | 3300042635 | Bacteria | 2667 |
| 177 | Ga0466704_076792 | 3300042643 | Bacteria | 27953 |
| 178 | Ga0466704_231274 | 3300042643 | Unclassified | 2808 |
| 179 | Ga0466709_240281 | 3300042648 | Bacteria | 1041 |
| 180 | Ga0466725_442121 | 3300042654 | Bacteria | 1915 |
| 181 | Ga0466727_218944 | 3300042655 | Bacteria | 1219 |
| 182 | Ga0466727_254850 | 3300042655 | Bacteria | 2666 |
| 183 | Ga0466727_280584 | 3300042655 | Bacteria | 2239 |
| 184 | JGI24698J34947_10058733 | 3300002449 | Bacteria | 1904 |
| 185 | JGI24702J35022_10000164 | 3300002462 | Bacteria | 34496 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.