Protein Family IF09523

Metagenome Isolate
204 Members
63 Samples
186 Scaffolds
393.28 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_491898|Ga0466704_491898_494_1858
Length
454 aa
Sequence
MSRNFVLEFLKKDKSRNYGFRGAYFLSVFAVYLKGFSFKISRSLKGMILFLLDCGRLMKQNISVVPVLLGKKWALSLKMLWGFLKMGKARLFPKRDYQFDHMKNLCLVYLKITALCNLRCVMCGQWGKKGVMKGCDIAAEAKKVLPLTDYQRLVDEIARRHPVMYIWGGEPFMYPDLIPLVKYMVDKGLFVSVNTNGTFLEKYAEVIVRDKWSTIFVSLDGFRDTNDAMRGKGAYDRAINGFRAINREKERQRSVYPVLGVVTTVTNLNYEDLDKLAEASREYKLDVHIFNLGTYTNDRIIAAQRAVMKEKLDTDINCLSGYNTGYNTQIDGKKLYAILQNLHKKNFGHPQITVPVLNPQKVHTYYADLEKPVRNHCIVPWCQTNINYNGDVHFCADYPDYILGNIKDASLAEIYNGDRANRFRKAIKSCEGGMFPGCLRCYQNMLFGKKIRGY

📊 Sample Types

Isolate 8.8%
Metagenome 91.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 36.1%
Unclassified 34.4%
Kalotermitidae 19.7%
Rhinotermitidae 4.9%
Termopsidae 3.3%
Hodotermitidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 182
Eukaryota 0
Viruses 0
Unclassified 22

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
2 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
3 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
4 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
5 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
6 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
7 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
8 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
9 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
10 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
11 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
12 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
13 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
14 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
17 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
18 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
19 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
20 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
21 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
22 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
23 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
24 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
25 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
26 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
27 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
28 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
29 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
30 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
31 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
32 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
33 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
34 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
35 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
36 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
37 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
38 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
39 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
40 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
41 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
42 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
43 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
44 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
45 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
46 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
47 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
48 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
49 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
50 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
51 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
52 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
53 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
54 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
55 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
56 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
57 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
58 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
59 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
60 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
61 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
62 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
63 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_248977 3300042656 Bacteria 20366
2 Ga0415639_009193 3300038395 Bacteria 4393
3 Ga0415639_021951 3300038395 Bacteria 22923
4 Ga0466699_289481 3300042597 Bacteria 3498
5 Ga0123356_10000512 3300010049 Bacteria 43209
6 Ga0123356_10148906 3300010049 Bacteria 2321
7 AustNasuHG_c1008290 3300000089 Bacteria 3684
8 AustNasuHG_c1017597 3300000089 Bacteria 2374
9 JGI24698J34947_10008565 3300002449 Bacteria 5615
10 JGI24698J34947_10012958 3300002449 Bacteria 4556
11 JGI24698J34947_10019037 3300002449 Unclassified 3707
12 JGI24695J34938_10000129 3300002450 Bacteria 68011
13 JGI24695J34938_10000749 3300002450 Bacteria 30507
14 JGI24695J34938_10003255 3300002450 Bacteria 11488
15 JGI24702J35022_10009802 3300002462 Bacteria 5370
16 Ga0466729_197982 3300042621 Bacteria 1485
17 Ga0466709_393694 3300042648 Bacteria 3305
18 Ga0466712_033340 3300042614 Bacteria 4549
19 Ga0466712_044744 3300042614 Bacteria 9496
20 Ga0466712_052591 3300042614 Bacteria 19320
21 Ga0466723_077145 3300042618 Bacteria 54484
22 Ga0466728_292206 3300042620 Bacteria 4834
23 Ga0466729_160677 3300042621 Bacteria 1650
24 Ga0466706_141034 3300042599 Bacteria 9321
25 Ga0466722_058686 3300042609 Bacteria 14294
26 Ga0466705_115968 3300042612 Unclassified 5301
27 Ga0264413_100302 3300024493 Bacteria 69754
28 Ga0264413_105598 3300024493 Bacteria 9330
29 Ga0466690_023298 3300042590 Bacteria 45810
30 Ga0466692_179052 3300042591 Unclassified 2708
31 Ga0466694_065842 3300042594 Bacteria 35703
32 Ga0466699_430748 3300042597 Bacteria 5883
33 Ga0123355_10042645 3300009826 Bacteria 7385
34 Ga0123356_10001164 3300010049 Bacteria 29125
35 JGI24698J34947_10000789 3300002449 Bacteria 15767
36 JGI24698J34947_10003716 3300002449 Unclassified 8298
37 JGI24698J34947_10047416 3300002449 Bacteria 2181
38 JGI24698J34947_10078752 3300002449 Bacteria 1553
39 JGI24695J34938_10000443 3300002450 Bacteria 40027
40 JGI24695J34938_10000452 3300002450 Bacteria 39831
41 JGI24695J34938_10001598 3300002450 Bacteria 19063
42 JGI24695J34938_10002974 3300002450 Bacteria 12214
43 JGI24695J34938_10019502 3300002450 Unclassified 3361
44 JGI24695J34938_10036484 3300002450 Bacteria 2240
45 JGI24699J35502_11115416 3300002509 Bacteria 2914
46 Ga0466731_437026 3300042622 Bacteria 3087
47 Ga0466702_390788 3300042635 Unclassified 7667
48 Ga0466704_487361 3300042643 Bacteria 16773
49 Ga0466712_244485 3300042614 Bacteria 43012
50 Ga0466707_408897 3300042601 Bacteria 5202
51 Ga0466720_029507 3300042607 Bacteria 14085
52 Ga0466690_124158 3300042590 Bacteria 1967
53 Ga0466693_078049 3300042592 Bacteria 7087
54 Ga0466691_108929 3300042593 Bacteria 10955
55 Ga0123356_10000340 3300010049 Bacteria 53881
56 Ga0123356_10067943 3300010049 Bacteria 3338
57 JGI24698J34947_10020149 3300002449 Bacteria 3596
58 JGI24695J34938_10000223 3300002450 Bacteria 53945
59 JGI24695J34938_10032940 3300002450 Bacteria 2389
60 JGI24695J34938_10044452 3300002450 Bacteria 1975
61 Ga0072941_1044056 3300005201 Bacteria 10382
62 Ga0466702_123183 3300042635 Bacteria 9423
63 Ga0466702_171084 3300042635 Bacteria 4321
64 Ga0466703_141366 3300042636 Unclassified 1496
65 Ga0466712_053938 3300042614 Bacteria 14656
66 Ga0466718_013504 3300042617 Bacteria 6408
67 Ga0466718_124181 3300042617 Bacteria 2522
68 Ga0466707_002172 3300042601 Bacteria 2667
69 Ga0466707_016160 3300042601 Bacteria 7699
70 Ga0466719_062336 3300042606 Bacteria 13098
71 Ga0466720_053217 3300042607 Bacteria 12094
72 Ga0466720_160110 3300042607 Unclassified 10244
73 Ga0466721_015027 3300042608 Bacteria 27932
74 Ga0466698_042411 3300042610 Bacteria 1202
75 Ga0466705_081544 3300042612 Bacteria 12858
76 Ga0466690_334608 3300042590 Bacteria 1491
77 Ga0466692_096313 3300042591 Unclassified 2575
78 Ga0466691_040871 3300042593 Bacteria 8562
79 Ga0466691_119416 3300042593 Bacteria 19747
80 Ga0466694_042883 3300042594 Bacteria 4964
81 Ga0466694_236252 3300042594 Bacteria 11024
82 Ga0123356_10000079 3300010049 Bacteria 103173
83 AustNasuHG_c1019340 3300000089 Unclassified 2236
84 JGI24698J34947_10004075 3300002449 Bacteria 7929
85 JGI24695J34938_10048374 3300002450 Bacteria 1873
86 Ga0466702_064415 3300042635 Bacteria 3135
87 Ga0466702_125600 3300042635 Bacteria 2281
88 Ga0466712_001299 3300042614 Bacteria 3856
89 Ga0466712_013066 3300042614 Bacteria 3272
90 Ga0466715_013285 3300042616 Bacteria 2588
91 Ga0466718_000086 3300042617 Bacteria 2947
92 Ga0466718_091367 3300042617 Bacteria 10241
93 Ga0466718_112919 3300042617 Unclassified 2022
94 Ga0466719_094348 3300042606 Bacteria 14801
95 Ga0466720_029282 3300042607 Bacteria 22130
96 Ga0466722_196767 3300042609 Unclassified 2848
97 Ga0466692_166337 3300042591 Bacteria 1744
98 Ga0466693_046844 3300042592 Bacteria 19759
99 Ga0123356_10018312 3300010049 Bacteria 6651
100 Ga0123353_10226196 3300010167 Bacteria 2921
101 JGI24696J40584_12951663 3300002834 Bacteria 2265
102 Ga0466703_086679 3300042636 Bacteria 3903
103 Ga0466703_090447 3300042636 Bacteria 1660
104 Ga0466704_263029 3300042643 Bacteria 10438
105 Ga0466704_491898 3300042643 Bacteria 3987
106 Ga0466712_007741 3300042614 Bacteria 8714
107 Ga0466712_012913 3300042614 Bacteria 7998
108 Ga0466712_016960 3300042614 Bacteria 2392
109 Ga0466712_138883 3300042614 Bacteria 7383
110 Ga0466712_155558 3300042614 Bacteria 36572
111 Ga0466718_001240 3300042617 Bacteria 19118
112 Ga0466718_025840 3300042617 Bacteria 3769
113 Ga0466718_047634 3300042617 Bacteria 13705
114 Ga0466718_057918 3300042617 Bacteria 18754
115 Ga0466718_100300 3300042617 Bacteria 9249
116 Ga0466723_100427 3300042618 Bacteria 22384
117 Ga0466728_070070 3300042620 Unclassified 1728
118 Ga0466720_131429 3300042607 Bacteria 12771
119 Ga0466690_249585 3300042590 Bacteria 6230
120 Ga0466692_202763 3300042591 Bacteria 8570
121 Ga0466694_079165 3300042594 Bacteria 40053
122 Ga0466694_337728 3300042594 Bacteria 3677
123 Ga0466699_008816 3300042597 Unclassified 1483
124 Ga0123353_10249662 3300010167 Bacteria 2749
125 AustNasuHG_c1005784 3300000089 Bacteria 4415
126 AustNasuHG_c1007824 3300000089 Unclassified 3791
127 JGI24698J34947_10004501 3300002449 Bacteria 7583
128 JGI24698J34947_10017027 3300002449 Bacteria 3942
129 JGI24698J34947_10083214 3300002449 Bacteria 1494
130 JGI24695J34938_10000812 3300002450 Bacteria 29016
131 JGI24695J34938_10004796 3300002450 Bacteria 8701
132 Ga0068305_10035371 3300005083 Bacteria 4753
133 Ga0072941_1131842 3300005201 Bacteria 2705
134 Ga0466731_146613 3300042622 Bacteria 26612
135 Ga0466704_503147 3300042643 Bacteria 8636
136 Ga0466708_141694 3300042652 Unclassified 1867
137 Ga0466712_213455 3300042614 Bacteria 4154
138 Ga0466726_331316 3300042619 Bacteria 3944
139 Ga0466726_471271 3300042619 Bacteria 2741
140 Ga0466729_146028 3300042621 Bacteria 1861
141 Ga0466720_098244 3300042607 Bacteria 17951
142 Ga0466720_182424 3300042607 Bacteria 3413
143 Ga0466722_071712 3300042609 Bacteria 4581
144 Ga0466732_073777 3300042656 Bacteria 3898
145 Ga0415639_029791 3300038395 Bacteria 2261
146 Ga0466699_144835 3300042597 Bacteria 41381
147 AustNasuHG_c1002447 3300000089 Bacteria 6715
148 AustNasuHG_c1014588 3300000089 Unclassified 2667
149 JGI24698J34947_10001602 3300002449 Bacteria 12030
150 JGI24695J34938_10000017 3300002450 Bacteria 115659
151 JGI24695J34938_10000933 3300002450 Bacteria 26685
152 JGI24695J34938_10004711 3300002450 Bacteria 8828
153 JGI24695J34938_10008768 3300002450 Bacteria 5727
154 JGI24695J34938_10034629 3300002450 Unclassified 2316
155 Ga0072941_1000589 3300005201 Bacteria 53863
156 Ga0466702_092852 3300042635 Bacteria 13928
157 Ga0466702_445906 3300042635 Bacteria 1828
158 Ga0466727_217349 3300042655 Bacteria 1853
159 Ga0466711_046852 3300042615 Bacteria 5275
160 Ga0466715_073116 3300042616 Bacteria 3201
161 Ga0466718_105346 3300042617 Bacteria 8415
162 Ga0466723_344665 3300042618 Bacteria 1577
163 Ga0466726_052184 3300042619 Bacteria 10126
164 Ga0466700_057453 3300042600 Bacteria 2438
165 Ga0466713_108088 3300042602 Bacteria 15039
166 Ga0466719_262025 3300042606 Bacteria 7777
167 Ga0466720_061585 3300042607 Unclassified 5337
168 Ga0466705_031578 3300042612 Bacteria 7092
169 Ga0466705_085217 3300042612 Bacteria 9564
170 Ga0466694_111042 3300042594 Bacteria 8877
171 AustNasuHG_c1006103 3300000089 Unclassified 4306
172 AustNasuHG_c1013849 3300000089 Bacteria 2756
173 JGI24698J34947_10012115 3300002449 Unclassified 4732
174 JGI24695J34938_10028396 3300002450 Bacteria 2630
175 JGI24695J34938_10033672 3300002450 Bacteria 2356
176 JGI24695J34938_10039159 3300002450 Bacteria 2143
177 Ga0072941_1076182 3300005201 Bacteria 3073
178 Ga0466704_260128 3300042643 Bacteria 2410
179 Ga0466712_104351 3300042614 Bacteria 15433
180 Ga0466711_081719 3300042615 Bacteria 20511
181 Ga0466718_159562 3300042617 Unclassified 2472
182 Ga0466723_280555 3300042618 Bacteria 24215
183 Ga0466720_017694 3300042607 Bacteria 2629
184 Ga0466720_026420 3300042607 Bacteria 22729
185 Ga0466720_219584 3300042607 Bacteria 92443
186 Ga0466722_214918 3300042609 Bacteria 11850

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04055 Radical_SAM Radical SAM superfamily 111 278 0.93
PF13186 SPASM Iron-sulfur cluster-binding domain 377 441 0.83

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.