Protein Family IF09490
Metagenome
Isolate
133
Members
32
Samples
127
Scaffolds
190.44
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_370048|Ga0466704_370048_6273_6917
- Length
- 214 aa
- Sequence
- MMNAKTPEPWCSGKKYKEYQMMIRYRSMFLLMLCAVMAFAACNQQGQSAPPASSVAAEDEAGFEEFPLGDDFELGPLNVAGVYFQPVDMLPSGQGLAAADSDVHLEADISALENELGYGVGDFVPNLTVDYEISQANGWRSEGTFMPMNASDGPHYGANLKLNGIGQYKIRFIIQNPEAQGYVLHVDQETGVNGRFWGQPLVAEWDFTYPGPSW
Sample Types
Isolate
4.5%
Metagenome
95.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
43.8%
Apidae
18.8%
Unclassified
18.8%
Rhinotermitidae
9.4%
Termopsidae
9.4%
Taxonomy
Archaea
0
Bacteria
116
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 2 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 3 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 4 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 5 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 6 | 2833532623 | Frischella perrara ESL0167 | Isolate | Apidae |
| 7 | 2684622921 | Frischella perrara Fp_167 | Isolate | Unclassified |
| 8 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 11 | 3300000459 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Frischia SCG AB-598-C04 | Metagenome | Apidae |
| 12 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 13 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 14 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 15 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 16 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 20 | 2515154034 | Frischella perrara PEB0191 | Isolate | Apidae |
| 21 | 2630968947 | Frischella perrara PEB0191 | Isolate | Apidae |
| 22 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 23 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 24 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 25 | 2756170266 | Frischella perrara DSM 104328 | Isolate | Unclassified |
| 26 | 3300000462 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Frischia SCG AB-598-I22 | Metagenome | Apidae |
| 27 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 28 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 29 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 30 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 31 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 32 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_236372 | 3300042601 | Bacteria | 1068 |
| 2 | Ga0466722_008070 | 3300042609 | Bacteria | 1715 |
| 3 | Ga0466722_127758 | 3300042609 | Bacteria | 4874 |
| 4 | Ga0466715_280362 | 3300042616 | Bacteria | 21006 |
| 5 | Ga0466723_043161 | 3300042618 | Bacteria | 40432 |
| 6 | Ga0466726_240676 | 3300042619 | Bacteria | 2668 |
| 7 | Ga0466726_313224 | 3300042619 | Bacteria | 1781 |
| 8 | Ga0466726_373851 | 3300042619 | Bacteria | 3534 |
| 9 | Ga0466692_045098 | 3300042591 | Bacteria | 3539 |
| 10 | Ga0466691_026108 | 3300042593 | Bacteria | 6547 |
| 11 | Ga0466703_128055 | 3300042636 | Bacteria | 2313 |
| 12 | Ga0466727_270780 | 3300042655 | Bacteria | 3188 |
| 13 | Ga0466705_221390 | 3300042612 | Unclassified | 1319 |
| 14 | Ga0466705_225447 | 3300042612 | Bacteria | 1282 |
| 15 | Ga0466707_213979 | 3300042601 | Bacteria | 1118 |
| 16 | Ga0466716_288822 | 3300042605 | Bacteria | 3332 |
| 17 | Ga0466722_195965 | 3300042609 | Bacteria | 1544 |
| 18 | Ga0466715_582572 | 3300042616 | Bacteria | 4469 |
| 19 | Ga0466723_041068 | 3300042618 | Bacteria | 7734 |
| 20 | Ga0466723_195905 | 3300042618 | Bacteria | 1191 |
| 21 | Ga0466726_099625 | 3300042619 | Bacteria | 4542 |
| 22 | Ga0466726_174549 | 3300042619 | Bacteria | 1078 |
| 23 | Ga0466692_197297 | 3300042591 | Unclassified | 1088 |
| 24 | Ga0466691_217449 | 3300042593 | Bacteria | 9384 |
| 25 | Ga0466735_086070 | 3300042624 | Bacteria | 1380 |
| 26 | Ga0466704_370048 | 3300042643 | Bacteria | 14256 |
| 27 | Ga0466708_277901 | 3300042652 | Bacteria | 8331 |
| 28 | Ga0466727_235718 | 3300042655 | Bacteria | 2208 |
| 29 | Ga0466719_053476 | 3300042606 | Bacteria | 9871 |
| 30 | Ga0068305_10929249 | 3300005083 | Bacteria | 1323 |
| 31 | Ga0466715_595157 | 3300042616 | Bacteria | 7827 |
| 32 | Ga0466723_061814 | 3300042618 | Bacteria | 8769 |
| 33 | Ga0466726_036925 | 3300042619 | Bacteria | 1559 |
| 34 | Ga0466726_092528 | 3300042619 | Bacteria | 1239 |
| 35 | Ga0466726_117753 | 3300042619 | Bacteria | 7555 |
| 36 | Ga0466726_217599 | 3300042619 | Bacteria | 5221 |
| 37 | Ga0466726_364998 | 3300042619 | Bacteria | 1977 |
| 38 | Ga0466726_391765 | 3300042619 | Unclassified | 1290 |
| 39 | Ga0466690_295172 | 3300042590 | Bacteria | 1451 |
| 40 | Ga0466692_163004 | 3300042591 | Bacteria | 30267 |
| 41 | Ga0466691_174787 | 3300042593 | Bacteria | 1218 |
| 42 | Ga0466704_114903 | 3300042643 | Bacteria | 80354 |
| 43 | Ga0466704_336668 | 3300042643 | Bacteria | 17570 |
| 44 | Ga0466709_049719 | 3300042648 | Bacteria | 5022 |
| 45 | Ga0466727_100431 | 3300042655 | Unclassified | 1890 |
| 46 | Ga0466727_127224 | 3300042655 | Unclassified | 2152 |
| 47 | Ga0466727_240459 | 3300042655 | Unclassified | 5932 |
| 48 | Ga0466705_099296 | 3300042612 | Bacteria | 9598 |
| 49 | Ga0466705_174586 | 3300042612 | Bacteria | 1647 |
| 50 | Ga0466707_254191 | 3300042601 | Bacteria | 1273 |
| 51 | Ga0466722_075132 | 3300042609 | Bacteria | 3604 |
| 52 | Ga0466722_161470 | 3300042609 | Bacteria | 1446 |
| 53 | Ga0466715_103386 | 3300042616 | Bacteria | 15655 |
| 54 | Ga0466715_479288 | 3300042616 | Bacteria | 6429 |
| 55 | Ga0466726_281750 | 3300042619 | Bacteria | 1213 |
| 56 | Ga0466726_483486 | 3300042619 | Bacteria | 1688 |
| 57 | Ga0456237_0008102 | 3300041968 | Unclassified | 1600 |
| 58 | Ga0466696_268944 | 3300042596 | Unclassified | 1351 |
| 59 | Ga0466703_031112 | 3300042636 | Bacteria | 9713 |
| 60 | Ga0466709_008067 | 3300042648 | Unclassified | 1478 |
| 61 | Ga0466709_212217 | 3300042648 | Bacteria | 2410 |
| 62 | Ga0466708_116236 | 3300042652 | Bacteria | 5532 |
| 63 | Ga0466708_357944 | 3300042652 | Bacteria | 10282 |
| 64 | Ga0466727_315186 | 3300042655 | Unclassified | 1612 |
| 65 | Ga0466727_350843 | 3300042655 | Bacteria | 4433 |
| 66 | Ga0466713_052964 | 3300042602 | Bacteria | 1189 |
| 67 | Ga0466716_367105 | 3300042605 | Bacteria | 4973 |
| 68 | Ga0466719_354697 | 3300042606 | Bacteria | 16235 |
| 69 | Ga0466719_490911 | 3300042606 | Bacteria | 1178 |
| 70 | Ga0466722_082738 | 3300042609 | Bacteria | 2577 |
| 71 | SCG598C04_11379 | 3300000459 | Unclassified | 20627 |
| 72 | Ga0466723_095111 | 3300042618 | Bacteria | 1252 |
| 73 | Ga0466723_118249 | 3300042618 | Bacteria | 3834 |
| 74 | Ga0466726_297039 | 3300042619 | Unclassified | 11774 |
| 75 | Ga0466728_101966 | 3300042620 | Bacteria | 40822 |
| 76 | Ga0466690_078600 | 3300042590 | Bacteria | 6937 |
| 77 | Ga0466692_201330 | 3300042591 | Unclassified | 2522 |
| 78 | Ga0466691_148496 | 3300042593 | Bacteria | 39094 |
| 79 | Ga0466691_170448 | 3300042593 | Bacteria | 9798 |
| 80 | Ga0466703_319980 | 3300042636 | Bacteria | 22455 |
| 81 | Ga0466705_035165 | 3300042612 | Bacteria | 12506 |
| 82 | Ga0466713_049193 | 3300042602 | Bacteria | 8390 |
| 83 | Ga0466719_184641 | 3300042606 | Bacteria | 1017 |
| 84 | Ga0466715_001281 | 3300042616 | Bacteria | 15032 |
| 85 | Ga0466723_226308 | 3300042618 | Unclassified | 1445 |
| 86 | Ga0466723_330406 | 3300042618 | Bacteria | 9779 |
| 87 | Ga0466726_103420 | 3300042619 | Bacteria | 1236 |
| 88 | Ga0466692_008460 | 3300042591 | Bacteria | 9827 |
| 89 | Ga0466703_259145 | 3300042636 | Bacteria | 15559 |
| 90 | Ga0466704_279926 | 3300042643 | Bacteria | 5444 |
| 91 | Ga0466708_082327 | 3300042652 | Bacteria | 12850 |
| 92 | Ga0466708_297671 | 3300042652 | Bacteria | 9014 |
| 93 | Ga0466727_120953 | 3300042655 | Bacteria | 3293 |
| 94 | Ga0466727_192343 | 3300042655 | Bacteria | 19086 |
| 95 | Ga0466713_014444 | 3300042602 | Bacteria | 5628 |
| 96 | Ga0466719_155164 | 3300042606 | Unclassified | 2211 |
| 97 | Ga0466722_159062 | 3300042609 | Bacteria | 2247 |
| 98 | SCG598I22_12470 | 3300000462 | Bacteria | 23937 |
| 99 | Ga0466711_039057 | 3300042615 | Bacteria | 8217 |
| 100 | Ga0466711_211696 | 3300042615 | Bacteria | 1120 |
| 101 | Ga0466711_309377 | 3300042615 | Bacteria | 15596 |
| 102 | Ga0466726_486954 | 3300042619 | Bacteria | 11120 |
| 103 | Ga0466728_469848 | 3300042620 | Bacteria | 2812 |
| 104 | Ga0466692_037659 | 3300042591 | Bacteria | 1684 |
| 105 | Ga0466692_190589 | 3300042591 | Bacteria | 2121 |
| 106 | Ga0466692_193888 | 3300042591 | Bacteria | 1556 |
| 107 | Ga0466696_063197 | 3300042596 | Bacteria | 2815 |
| 108 | Ga0466709_219292 | 3300042648 | Bacteria | 7822 |
| 109 | Ga0466709_270450 | 3300042648 | Bacteria | 23228 |
| 110 | Ga0466708_025466 | 3300042652 | Bacteria | 3803 |
| 111 | Ga0466705_108381 | 3300042612 | Bacteria | 12796 |
| 112 | Ga0466705_234441 | 3300042612 | Bacteria | 11959 |
| 113 | Ga0466707_013814 | 3300042601 | Bacteria | 1040 |
| 114 | Ga0466713_122427 | 3300042602 | Bacteria | 12572 |
| 115 | Ga0466716_195947 | 3300042605 | Bacteria | 29935 |
| 116 | Ga0466719_113060 | 3300042606 | Bacteria | 20304 |
| 117 | Ga0466722_154020 | 3300042609 | Bacteria | 4212 |
| 118 | gam1t_NODE_110906_length=43291_GC=33_7_Contigs=2 | 2189573031 | Unclassified | 43301 |
| 119 | Ga0466726_138251 | 3300042619 | Bacteria | 2024 |
| 120 | Ga0466726_360797 | 3300042619 | Bacteria | 1141 |
| 121 | Ga0466728_114086 | 3300042620 | Bacteria | 27635 |
| 122 | Ga0456237_0005240 | 3300041968 | Unclassified | 2059 |
| 123 | Ga0466692_082074 | 3300042591 | Bacteria | 16594 |
| 124 | Ga0466696_010718 | 3300042596 | Bacteria | 2215 |
| 125 | Ga0466735_012246 | 3300042624 | Bacteria | 4979 |
| 126 | Ga0466703_062487 | 3300042636 | Bacteria | 7046 |
| 127 | Ga0466727_324268 | 3300042655 | Bacteria | 1268 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF10634 | Iron_transport | Fe2+ transport protein | 63 | 211 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.