Protein Family IF09480
Metagenome
Isolate
156
Members
71
Samples
139
Scaffolds
363.4
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_352796|Ga0466704_352796_565_1791
- Length
- 408 aa
- Sequence
- MNIYPKLILDALTKVRYPGTGKNLVEAGMVEDDIRIEGRKVSFTLRFERPGDPFVKSVVKAAETAILTYISPEIDIKGHIAARSLHDARPEPAKLLPEVANIIAVASGKGGVGKSTVSANLAVALAAAGYKTGLLDADIFGPSQPKMFNMEDARPYLAKTGSRDLIQPAENYGVKLLSIGFFVNRDDAVLWRGAMASSALKQLIGDANWGALDYLLIDLPPGTGDIHLTLVQTLAITGAVIVCTPQEVALADARKGINMFTGEKVNVPVLGLIENMAWFTPAELPESRYYIFGKDGGRRLAEELNIPLLGQIPLVQSICESGDAGAPAALNPATTTGAAFHDLAASVVKHAEYRRTHLAPTKRVEPHKSPENSLSRACRNLWTAHHCHRRDAMHRVSTLHPAQSIVNQ
Sample Types
Isolate
10.9%
Metagenome
89.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
21.5%
Termitidae
18.5%
Unclassified
12.3%
Armadillidiidae
12.3%
Termopsidae
6.2%
Rhinotermitidae
6.2%
Drosophilidae
4.6%
Blattidae
4.6%
Hydrophilidae
3.1%
Formicidae
3.1%
Passalidae
3.1%
Hodotermitidae
1.5%
Daphniidae
1.5%
Bombycidae
1.5%
Taxonomy
Archaea
0
Bacteria
150
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 2 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 3 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 4 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 13 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 16 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 17 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 18 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 19 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 20 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 21 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 24 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 25 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 28 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 29 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 30 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 31 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 32 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 33 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 34 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 35 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 36 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 37 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 38 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 39 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 40 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 41 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 42 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 43 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 44 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 45 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 46 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 47 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 48 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 49 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 50 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 51 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 52 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 53 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 54 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 55 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 56 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 57 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 58 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 59 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 60 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 61 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 62 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 63 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 64 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 65 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 66 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 67 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 68 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 69 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 70 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 71 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466701_029789 | 3300042598 | Bacteria | 6449 |
| 2 | Ga0466707_163288 | 3300042601 | Bacteria | 4077 |
| 3 | Ga0466707_345716 | 3300042601 | Unclassified | 1853 |
| 4 | Ga0466713_084333 | 3300042602 | Bacteria | 18300 |
| 5 | Ga0466713_091714 | 3300042602 | Bacteria | 189911 |
| 6 | Ga0466716_152838 | 3300042605 | Bacteria | 5263 |
| 7 | Ga0466691_062738 | 3300042593 | Bacteria | 3090 |
| 8 | Ga0466696_050799 | 3300042596 | Bacteria | 6802 |
| 9 | 2227550760 | 2225789004 | Bacteria | 2853 |
| 10 | Ga0068302_10125204 | 3300005071 | Bacteria | 3674 |
| 11 | Ga0104045_1001911 | 3300007085 | Bacteria | 29584 |
| 12 | Ga0466715_521826 | 3300042616 | Bacteria | 60910 |
| 13 | Ga0466726_411516 | 3300042619 | Bacteria | 1622 |
| 14 | Ga0466728_215085 | 3300042620 | Bacteria | 3023 |
| 15 | Ga0160454_100001 | 3300012798 | Bacteria | 780029 |
| 16 | Ga0466734_127602 | 3300042623 | Bacteria | 5809 |
| 17 | Ga0466735_029769 | 3300042624 | Bacteria | 1285 |
| 18 | Ga0466735_197399 | 3300042624 | Bacteria | 2853 |
| 19 | Ga0466704_030869 | 3300042643 | Bacteria | 10856 |
| 20 | Ga0466704_059884 | 3300042643 | Bacteria | 4890 |
| 21 | Ga0466724_32925 | 3300042649 | Bacteria | 56965 |
| 22 | Ga0466701_102904 | 3300042598 | Bacteria | 15591 |
| 23 | Ga0466714_001570 | 3300042603 | Bacteria | 47055 |
| 24 | Ga0466722_221028 | 3300042609 | Bacteria | 5942 |
| 25 | Ga0160469_100604 | 3300012824 | Bacteria | 14415 |
| 26 | Ga0160433_100678 | 3300012846 | Bacteria | 13215 |
| 27 | Ga0160445_100229 | 3300012847 | Bacteria | 40847 |
| 28 | Ga0466696_037072 | 3300042596 | Bacteria | 13930 |
| 29 | Ga0466696_095930 | 3300042596 | Bacteria | 3206 |
| 30 | IMNBL1DRAFT_c0001607 | 3300000062 | Bacteria | 16748 |
| 31 | Ga0068302_10095672 | 3300005071 | Bacteria | 1277 |
| 32 | Ga0466705_096447 | 3300042612 | Bacteria | 32294 |
| 33 | Ga0466705_179193 | 3300042612 | Bacteria | 7849 |
| 34 | Ga0466723_090796 | 3300042618 | Bacteria | 23724 |
| 35 | Ga0466726_161014 | 3300042619 | Bacteria | 1523 |
| 36 | Ga0466728_192580 | 3300042620 | Bacteria | 10511 |
| 37 | Ga0466729_227725 | 3300042621 | Bacteria | 4095 |
| 38 | Ga0466735_053155 | 3300042624 | Bacteria | 1807 |
| 39 | Ga0466703_210758 | 3300042636 | Bacteria | 2452 |
| 40 | Ga0466704_352796 | 3300042643 | Bacteria | 3086 |
| 41 | Ga0466709_044971 | 3300042648 | Bacteria | 10751 |
| 42 | Ga0466727_137368 | 3300042655 | Bacteria | 15897 |
| 43 | Ga0160456_100034 | 3300012820 | Bacteria | 215854 |
| 44 | Ga0160443_100103 | 3300012848 | Bacteria | 135933 |
| 45 | Ga0466692_103340 | 3300042591 | Bacteria | 5892 |
| 46 | Ga0466692_165217 | 3300042591 | Bacteria | 3405 |
| 47 | CVPL010W_10003257 | 3300002931 | Bacteria | 18743 |
| 48 | Ga0104050_1000996 | 3300007153 | Bacteria | 7884 |
| 49 | Ga0466711_354371 | 3300042615 | Bacteria | 7893 |
| 50 | Ga0466706_101829 | 3300042599 | Bacteria | 48819 |
| 51 | Ga0466706_219061 | 3300042599 | Bacteria | 18431 |
| 52 | Ga0466707_257671 | 3300042601 | Bacteria | 4852 |
| 53 | Ga0466719_026084 | 3300042606 | Bacteria | 7596 |
| 54 | Ga0466722_062666 | 3300042609 | Bacteria | 12412 |
| 55 | Ga0160467_100018 | 3300012829 | Bacteria | 326466 |
| 56 | Ga0160433_100012 | 3300012846 | Bacteria | 265415 |
| 57 | Ga0466690_013407 | 3300042590 | Bacteria | 18918 |
| 58 | IMNBL1DRAFT_c0012748 | 3300000062 | Bacteria | 3823 |
| 59 | Ga0466723_147651 | 3300042618 | Bacteria | 6618 |
| 60 | Ga0123357_10055779 | 3300009784 | Bacteria | 5317 |
| 61 | Ga0466730_054806 | 3300042625 | Bacteria | 801523 |
| 62 | Ga0466704_019328 | 3300042643 | Bacteria | 11527 |
| 63 | Ga0466709_203051 | 3300042648 | Bacteria | 4756 |
| 64 | Ga0466733_101223 | 3300042659 | Bacteria | 57262 |
| 65 | Ga0466733_188075 | 3300042659 | Bacteria | 2192 |
| 66 | Ga0466707_382404 | 3300042601 | Unclassified | 17120 |
| 67 | Ga0466719_242108 | 3300042606 | Bacteria | 2354 |
| 68 | Ga0466719_321417 | 3300042606 | Bacteria | 1720 |
| 69 | Ga0466690_395845 | 3300042590 | Bacteria | 33359 |
| 70 | Ga0466692_043899 | 3300042591 | Bacteria | 67267 |
| 71 | Ga0466692_048325 | 3300042591 | Bacteria | 14646 |
| 72 | IMNBL1DRAFT_c0001056 | 3300000062 | Bacteria | 21318 |
| 73 | JGI24699J35502_11134204 | 3300002509 | Bacteria | 55998 |
| 74 | Ga0104048_1000827 | 3300007143 | Bacteria | 25782 |
| 75 | Ga0466705_192895 | 3300042612 | Bacteria | 2202 |
| 76 | Ga0466705_215835 | 3300042612 | Bacteria | 18423 |
| 77 | Ga0466711_023837 | 3300042615 | Bacteria | 62988 |
| 78 | Ga0466723_028498 | 3300042618 | Bacteria | 28867 |
| 79 | Ga0123353_10151234 | 3300010167 | Bacteria | 3706 |
| 80 | Ga0466735_167781 | 3300042624 | Bacteria | 8315 |
| 81 | Ga0466703_112325 | 3300042636 | Bacteria | 3387 |
| 82 | Ga0466704_326679 | 3300042643 | Bacteria | 4975 |
| 83 | Ga0466704_362206 | 3300042643 | Bacteria | 17907 |
| 84 | Ga0466727_016365 | 3300042655 | Bacteria | 14084 |
| 85 | Ga0466727_277804 | 3300042655 | Bacteria | 5488 |
| 86 | Ga0466706_130997 | 3300042599 | Bacteria | 2926 |
| 87 | Ga0466706_284495 | 3300042599 | Bacteria | 4226 |
| 88 | Ga0466707_012249 | 3300042601 | Bacteria | 25629 |
| 89 | Ga0466707_316107 | 3300042601 | Bacteria | 20051 |
| 90 | Ga0466713_016914 | 3300042602 | Bacteria | 10979 |
| 91 | Ga0466716_294775 | 3300042605 | Bacteria | 9847 |
| 92 | Ga0466722_241799 | 3300042609 | Bacteria | 9410 |
| 93 | Ga0466691_043429 | 3300042593 | Bacteria | 4236 |
| 94 | Ga0466691_206071 | 3300042593 | Bacteria | 26570 |
| 95 | Ga0466694_292217 | 3300042594 | Bacteria | 2134 |
| 96 | JGI24702J35022_10002707 | 3300002462 | Bacteria | 10755 |
| 97 | Ga0466705_325889 | 3300042612 | Bacteria | 2673 |
| 98 | Ga0466715_242562 | 3300042616 | Bacteria | 39443 |
| 99 | Ga0466715_604876 | 3300042616 | Bacteria | 36456 |
| 100 | Ga0466723_178619 | 3300042618 | Bacteria | 21638 |
| 101 | Ga0466726_210074 | 3300042619 | Bacteria | 5124 |
| 102 | Ga0466735_164553 | 3300042624 | Bacteria | 5417 |
| 103 | Ga0466703_330629 | 3300042636 | Bacteria | 1656 |
| 104 | Ga0466704_036478 | 3300042643 | Bacteria | 21164 |
| 105 | Ga0466709_128488 | 3300042648 | Bacteria | 12684 |
| 106 | Ga0466724_46431 | 3300042649 | Unclassified | 5667 |
| 107 | Ga0466700_387454 | 3300042600 | Bacteria | 47059 |
| 108 | Ga0466707_078274 | 3300042601 | Bacteria | 2769 |
| 109 | Ga0466713_077407 | 3300042602 | Bacteria | 3574 |
| 110 | Ga0466713_091524 | 3300042602 | Bacteria | 31228 |
| 111 | Ga0466716_100304 | 3300042605 | Bacteria | 28707 |
| 112 | Ga0160455_100062 | 3300012837 | Bacteria | 204480 |
| 113 | Ga0160457_1000384 | 3300012858 | Unclassified | 23700 |
| 114 | Ga0466696_173954 | 3300042596 | Bacteria | 14904 |
| 115 | Ga0104045_1005451 | 3300007085 | Bacteria | 10564 |
| 116 | Ga0466715_150026 | 3300042616 | Bacteria | 9435 |
| 117 | Ga0160465_100006 | 3300012803 | Bacteria | 411486 |
| 118 | Ga0466735_095197 | 3300042624 | Bacteria | 1754 |
| 119 | Ga0466735_147767 | 3300042624 | Bacteria | 1564 |
| 120 | Ga0466704_051515 | 3300042643 | Bacteria | 3374 |
| 121 | Ga0466704_260868 | 3300042643 | Bacteria | 18144 |
| 122 | Ga0466724_07335 | 3300042649 | Bacteria | 37493 |
| 123 | Ga0466724_28482 | 3300042649 | Unclassified | 5803 |
| 124 | Ga0466708_145251 | 3300042652 | Bacteria | 10039 |
| 125 | Ga0466707_235811 | 3300042601 | Bacteria | 10350 |
| 126 | Ga0466707_309055 | 3300042601 | Bacteria | 10994 |
| 127 | Ga0160469_104121 | 3300012824 | Unclassified | 1774 |
| 128 | Ga0160467_100575 | 3300012829 | Bacteria | 32125 |
| 129 | Ga0466692_096609 | 3300042591 | Bacteria | 4032 |
| 130 | Ga0466696_151110 | 3300042596 | Bacteria | 63406 |
| 131 | Ga0466696_400723 | 3300042596 | Bacteria | 2195 |
| 132 | Ga0466701_014287 | 3300042598 | Bacteria | 17987 |
| 133 | Ga0068305_10048086 | 3300005083 | Bacteria | 11360 |
| 134 | Ga0102740_1000411 | 3300007140 | Bacteria | 11880 |
| 135 | Ga0466715_111704 | 3300042616 | Bacteria | 7380 |
| 136 | Ga0466715_624205 | 3300042616 | Bacteria | 21451 |
| 137 | Ga0466728_241856 | 3300042620 | Bacteria | 16233 |
| 138 | Ga0466735_013173 | 3300042624 | Bacteria | 6727 |
| 139 | Ga0466703_159768 | 3300042636 | Bacteria | 3135 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01883 | FeS_assembly_P | Iron-sulfur cluster assembly protein | 8 | 67 | 0.96 |
| PF10609 | ParA | NUBPL iron-transfer P-loop NTPase | 99 | 347 | 0.93 |
| PF02374 | ArsA_ATPase | Anion-transporting ATPase | 105 | 138 | 0.89 |
| PF09140 | MipZ | ATPase MipZ | 102 | 146 | 0.82 |
| PF13614 | AAA_31 | AAA domain | 101 | 245 | 0.79 |
| PF01656 | CbiA | CobQ/CobB/MinD/ParA nucleotide binding domain | 103 | 323 | 0.77 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.