Protein Family IF09477
Metagenome
Isolate
141
Members
57
Samples
123
Scaffolds
256.24
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_348116|Ga0466704_348116_1033_2040
- Length
- 299 aa
- Sequence
- MEDKSVLRILEKFEKMDLAERVEGKVDAIAEQTAHFMEFETDSAMAQKEFPILEFDEDRNAFIRPSKPLQPIDIAEGCVLCFFAEAIEKILVECPHKIVKTLISESSRMPVYELDYNGKRVALVQAIVGAPLAAGQIEELTALGCRKYIACGGCGVLQKEIAVGHLIIPAAAVRDEGTSYHYVEPSREIGLDERVISVIENTLAEQKVPYIKSKTWTTDAFYRETPAKIQQRKAEGCITVEMETSAYAAAAQYNGVDFGQILYAGDNLGGDAWDKRGWHDRSEIRAFVLRLALDVCIRL
Sample Types
Isolate
12.8%
Metagenome
87.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.4%
Unclassified
35.7%
Kalotermitidae
12.5%
Rhinotermitidae
5.4%
Taxonomy
Archaea
3
Bacteria
128
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820845766 | Unclassified Actinobacteria Lab288P3bin96 | Isolate | Unclassified |
| 2 | 2820593525 | Unclassified Firmicutes Emb289P1bin7 | Isolate | Unclassified |
| 3 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 4 | 2820676843 | Unclassified Firmicutes Co191P3bin17 | Isolate | Unclassified |
| 5 | 2820707375 | Unclassified Firmicutes Co191P1bin31 | Isolate | Unclassified |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 8 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 9 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 10 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 11 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 12 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 13 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 14 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 15 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 16 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 17 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 18 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 19 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 20 | 2228664003 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA | Metagenome | Termitidae |
| 21 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 22 | 2820418027 | Unclassified Firmicutes Lab288P3bin85 | Isolate | Unclassified |
| 23 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 24 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 25 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 26 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 29 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 30 | 2820623020 | Unclassified Firmicutes Emb289P1bin126 | Isolate | Unclassified |
| 31 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 32 | 2820696217 | Unclassified Firmicutes Co191P1bin66 | Isolate | Unclassified |
| 33 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 34 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 35 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 36 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 37 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 38 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 39 | 2820894511 | Unclassified Actinobacteria Lab288P1bin103 | Isolate | Unclassified |
| 40 | 2820663833 | Unclassified Firmicutes Co191P3bin41 | Isolate | Unclassified |
| 41 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 42 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 43 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 44 | 2820408893 | Unclassified Firmicutes Lab288P4bin80 | Isolate | Unclassified |
| 45 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 46 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 47 | 2820698910 | Unclassified Firmicutes Co191P1bin64 | Isolate | Unclassified |
| 48 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 49 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 50 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 51 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 52 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 53 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 54 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 55 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 56 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 57 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_123013 | 3300042656 | Bacteria | 3727 |
| 2 | Ga0466731_149801 | 3300042622 | Bacteria | 14449 |
| 3 | Ga0123355_10020495 | 3300009826 | Bacteria | 10561 |
| 4 | Ga0123353_10000484 | 3300010167 | Bacteria | 49147 |
| 5 | Ga0415639_174773 | 3300038395 | Bacteria | 1392 |
| 6 | Ga0466699_065720 | 3300042597 | Bacteria | 30315 |
| 7 | Ga0466722_044388 | 3300042609 | Bacteria | 1807 |
| 8 | JGI24698J34947_10000084 | 3300002449 | Bacteria | 30983 |
| 9 | JGI24698J34947_10046444 | 3300002449 | Bacteria | 2209 |
| 10 | Ga0466712_094060 | 3300042614 | Unclassified | 2280 |
| 11 | Ga0466732_006890 | 3300042656 | Bacteria | 2413 |
| 12 | Ga0123355_10001001 | 3300009826 | Bacteria | 39166 |
| 13 | Ga0123355_10001176 | 3300009826 | Bacteria | 36339 |
| 14 | Ga0123355_10004344 | 3300009826 | Bacteria | 20618 |
| 15 | Ga0123356_10006946 | 3300010049 | Bacteria | 11365 |
| 16 | Ga0123353_10000954 | 3300010167 | Bacteria | 35352 |
| 17 | Ga0123353_10021230 | 3300010167 | Bacteria | 9739 |
| 18 | Ga0123354_10095949 | 3300010882 | Bacteria | 4055 |
| 19 | Ga0466693_085538 | 3300042592 | Bacteria | 2541 |
| 20 | Ga0466699_042459 | 3300042597 | Bacteria | 6941 |
| 21 | Ga0466699_283828 | 3300042597 | Bacteria | 1571 |
| 22 | Ga0466713_114115 | 3300042602 | Bacteria | 15311 |
| 23 | JGI24698J34947_10005101 | 3300002449 | Bacteria | 7196 |
| 24 | JGI24698J34947_10030392 | 3300002449 | Bacteria | 2849 |
| 25 | JGI24698J34947_10054183 | 3300002449 | Bacteria | 2004 |
| 26 | JGI24698J34947_10072314 | 3300002449 | Bacteria | 1651 |
| 27 | JGI24695J34938_10061373 | 3300002450 | Unclassified | 1600 |
| 28 | Ga0466710_161426 | 3300042613 | Bacteria | 1583 |
| 29 | Ga0466712_081686 | 3300042614 | Bacteria | 21654 |
| 30 | Ga0466712_157163 | 3300042614 | Bacteria | 15138 |
| 31 | Ga0466712_239136 | 3300042614 | Bacteria | 6837 |
| 32 | Ga0466733_193682 | 3300042659 | Bacteria | 3584 |
| 33 | Ga0466725_455920 | 3300042654 | Bacteria | 1230 |
| 34 | Ga0123355_10049263 | 3300009826 | Bacteria | 6850 |
| 35 | Ga0123355_10154394 | 3300009826 | Bacteria | 3477 |
| 36 | Ga0123356_10805401 | 3300010049 | Bacteria | 1110 |
| 37 | Ga0123356_11367644 | 3300010049 | Bacteria | 869 |
| 38 | Ga0123354_10035316 | 3300010882 | Bacteria | 7805 |
| 39 | Ga0466693_286037 | 3300042592 | Bacteria | 3395 |
| 40 | Ga0466694_221664 | 3300042594 | Archaea | 3853 |
| 41 | Ga0466699_133193 | 3300042597 | Bacteria | 1360 |
| 42 | Ga0466707_308941 | 3300042601 | Bacteria | 1263 |
| 43 | Ga0466719_250345 | 3300042606 | Bacteria | 2283 |
| 44 | JGI24698J34947_10008938 | 3300002449 | Unclassified | 5493 |
| 45 | Ga0466712_110393 | 3300042614 | Bacteria | 1591 |
| 46 | Ga0466712_137789 | 3300042614 | Bacteria | 4246 |
| 47 | Ga0466712_161189 | 3300042614 | Bacteria | 1973 |
| 48 | Ga0466712_275674 | 3300042614 | Bacteria | 23810 |
| 49 | Ga0466732_038294 | 3300042656 | Bacteria | 1567 |
| 50 | Ga0466709_395200 | 3300042648 | Bacteria | 34893 |
| 51 | Ga0123355_10014958 | 3300009826 | Bacteria | 12161 |
| 52 | Ga0123356_10854690 | 3300010049 | Bacteria | 1081 |
| 53 | Ga0123353_10243585 | 3300010167 | Bacteria | 2791 |
| 54 | Ga0466716_019376 | 3300042605 | Bacteria | 6255 |
| 55 | Ga0466722_012775 | 3300042609 | Bacteria | 3195 |
| 56 | Ga0466698_061345 | 3300042610 | Bacteria | 1056 |
| 57 | AustNasuHG_c1009116 | 3300000089 | Bacteria | 3494 |
| 58 | JGI24698J34947_10126680 | 3300002449 | Bacteria | 1099 |
| 59 | JGI24695J34938_10000022 | 3300002450 | Bacteria | 111549 |
| 60 | JGI24695J34938_10001283 | 3300002450 | Bacteria | 22012 |
| 61 | JGI24695J34938_10001973 | 3300002450 | Bacteria | 16389 |
| 62 | Ga0072940_1167668 | 3300005200 | Bacteria | 1690 |
| 63 | Ga0456237_0000695 | 3300041968 | Bacteria | 5150 |
| 64 | Ga0466657_046948 | 3300042582 | Bacteria | 1949 |
| 65 | Ga0466692_005397 | 3300042591 | Unclassified | 4687 |
| 66 | Ga0466699_266836 | 3300042597 | Bacteria | 1560 |
| 67 | Ga0466700_445554 | 3300042600 | Bacteria | 5606 |
| 68 | JGI24698J34947_10000205 | 3300002449 | Bacteria | 24069 |
| 69 | JGI24698J34947_10031925 | 3300002449 | Bacteria | 2768 |
| 70 | JGI24698J34947_10055954 | 3300002449 | Bacteria | 1963 |
| 71 | Ga0466712_044780 | 3300042614 | Bacteria | 7230 |
| 72 | Ga0466703_098182 | 3300042636 | Bacteria | 15954 |
| 73 | Ga0123355_10517215 | 3300009826 | Bacteria | 1462 |
| 74 | Ga0123353_10001240 | 3300010167 | Archaea | 31262 |
| 75 | Ga0123353_10004866 | 3300010167 | Bacteria | 17450 |
| 76 | Ga0123353_10780098 | 3300010167 | Archaea | 1324 |
| 77 | Ga0466693_227409 | 3300042592 | Bacteria | 1467 |
| 78 | Ga0466694_205477 | 3300042594 | Bacteria | 1523 |
| 79 | Ga0466699_273180 | 3300042597 | Unclassified | 2146 |
| 80 | Ga0466707_049839 | 3300042601 | Bacteria | 8553 |
| 81 | JGI24698J34947_10042170 | 3300002449 | Unclassified | 2346 |
| 82 | JGI24698J34947_10049961 | 3300002449 | Bacteria | 2111 |
| 83 | JGI24698J34947_10114331 | 3300002449 | Bacteria | 1184 |
| 84 | JGI24699J35502_11108489 | 3300002509 | Bacteria | 2597 |
| 85 | JGI24696J40584_12938797 | 3300002834 | Bacteria | 1636 |
| 86 | Ga0072940_1097688 | 3300005200 | Bacteria | 3259 |
| 87 | Ga0466710_227627 | 3300042613 | Bacteria | 1771 |
| 88 | Ga0466718_044723 | 3300042617 | Bacteria | 2435 |
| 89 | Ga0466718_048431 | 3300042617 | Bacteria | 79612 |
| 90 | Ga0466705_114038 | 3300042612 | Bacteria | 30104 |
| 91 | Ga0466704_348116 | 3300042643 | Bacteria | 4517 |
| 92 | Ga0123355_10010573 | 3300009826 | Bacteria | 14166 |
| 93 | Ga0123355_10011413 | 3300009826 | Bacteria | 13692 |
| 94 | Ga0415639_229958 | 3300038395 | Bacteria | 1277 |
| 95 | Ga0466690_299623 | 3300042590 | Unclassified | 1655 |
| 96 | Ga0466699_358136 | 3300042597 | Bacteria | 2644 |
| 97 | Ga0466714_025050 | 3300042603 | Bacteria | 3481 |
| 98 | JGI24698J34947_10078757 | 3300002449 | Unclassified | 1553 |
| 99 | JGI24695J34938_10000579 | 3300002450 | Bacteria | 35323 |
| 100 | JGI24695J34938_10068247 | 3300002450 | Bacteria | 1494 |
| 101 | JGI24696J40584_12803091 | 3300002834 | Bacteria | 873 |
| 102 | Ga0072940_1038650 | 3300005200 | Bacteria | 4506 |
| 103 | Ga0072940_1082546 | 3300005200 | Bacteria | 3998 |
| 104 | Ga0466712_134384 | 3300042614 | Bacteria | 15093 |
| 105 | Ga0466718_069944 | 3300042617 | Bacteria | 2143 |
| 106 | Ga0466733_173009 | 3300042659 | Bacteria | 30039 |
| 107 | Ga0123353_10266795 | 3300010167 | Bacteria | 2640 |
| 108 | Ga0123354_10063783 | 3300010882 | Bacteria | 5411 |
| 109 | Ga0123354_10277722 | 3300010882 | Bacteria | 1634 |
| 110 | Ga0415639_143986 | 3300038395 | Bacteria | 1651 |
| 111 | Ga0466693_224013 | 3300042592 | Bacteria | 1726 |
| 112 | Ga0466694_002224 | 3300042594 | Bacteria | 1243 |
| 113 | Ga0466694_177275 | 3300042594 | Unclassified | 1917 |
| 114 | Ga0466694_358187 | 3300042594 | Bacteria | 1172 |
| 115 | Ga0466699_188855 | 3300042597 | Bacteria | 1010 |
| 116 | Ga0466699_338969 | 3300042597 | Bacteria | 1149 |
| 117 | Ga0466716_398003 | 3300042605 | Unclassified | 1138 |
| 118 | 2230954307 | 2228664003 | Bacteria | 3392 |
| 119 | JGI24695J34938_10000351 | 3300002450 | Bacteria | 45430 |
| 120 | Ga0072941_1019594 | 3300005201 | Bacteria | 15101 |
| 121 | Ga0072941_1081528 | 3300005201 | Bacteria | 2861 |
| 122 | Ga0466712_075904 | 3300042614 | Bacteria | 2435 |
| 123 | Ga0466718_027369 | 3300042617 | Bacteria | 6597 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01048 | PNP_UDP_1 | Phosphorylase superfamily | 105 | 272 | 0.87 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.