Protein Family IF09473
Metagenome
Isolate
209
Members
63
Samples
194
Scaffolds
231.32
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_342826|Ga0466704_342826_4972_5679
- Length
- 235 aa
- Sequence
- MWNFQEGEILYFDKPLHWTSFDLINKVRYQISRALKIKKIKVGHAGTLDPLATGVMIVCTGPATKRIEEFQYQTKEYIATLRLGATTPSFDLETEIDHTYPASVTQQQVEQILPQFLGRIEQIPPAFSACKVNGNRAYQLARKGEEVSLQPKTLIIDEIELLDFKPNELKIRVLCSKGTYIRALARDIGQALHSGAHLIALQRTRIGAVTLNDCLSIEQWNSLLFPTSELINNHP
Sample Types
Isolate
7.2%
Metagenome
92.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
30.2%
Kalotermitidae
22.2%
Unclassified
12.7%
Blattidae
11.1%
Termopsidae
6.3%
Rhinotermitidae
6.3%
Passalidae
4.8%
Hydrophilidae
3.2%
Hodotermitidae
1.6%
Tenebrionidae
1.6%
Taxonomy
Archaea
0
Bacteria
208
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 2 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 3 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 15 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 16 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 17 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 18 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 19 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 20 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 21 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 22 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 23 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 24 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 25 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 28 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 29 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 30 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 31 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 32 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 33 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 37 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 38 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 39 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 40 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 41 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 42 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 43 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 44 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 45 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 46 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 47 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 48 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 49 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 50 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 51 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 52 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 53 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 54 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 55 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 56 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 57 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 58 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 59 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 60 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 61 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 62 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 63 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10015250 | 3300009784 | Bacteria | 10074 |
| 2 | Ga0123357_10022776 | 3300009784 | Bacteria | 8404 |
| 3 | Ga0466703_005407 | 3300042636 | Bacteria | 8249 |
| 4 | Ga0466703_156231 | 3300042636 | Bacteria | 8237 |
| 5 | Ga0466704_096675 | 3300042643 | Bacteria | 5682 |
| 6 | Ga0466704_540065 | 3300042643 | Bacteria | 11117 |
| 7 | Ga0466708_080881 | 3300042652 | Bacteria | 15574 |
| 8 | Ga0466708_246412 | 3300042652 | Bacteria | 11145 |
| 9 | Ga0466727_270580 | 3300042655 | Bacteria | 6936 |
| 10 | Ga0466690_146535 | 3300042590 | Bacteria | 8131 |
| 11 | Ga0466693_421468 | 3300042592 | Bacteria | 2705 |
| 12 | Ga0466691_111298 | 3300042593 | Bacteria | 6981 |
| 13 | Ga0466711_176561 | 3300042615 | Bacteria | 3560 |
| 14 | Ga0466711_463674 | 3300042615 | Bacteria | 2441 |
| 15 | Ga0466715_119466 | 3300042616 | Bacteria | 7186 |
| 16 | Ga0466715_274255 | 3300042616 | Bacteria | 20116 |
| 17 | Ga0466715_546483 | 3300042616 | Bacteria | 18843 |
| 18 | Ga0466723_153364 | 3300042618 | Bacteria | 4952 |
| 19 | Ga0466726_005269 | 3300042619 | Bacteria | 1171 |
| 20 | Ga0466728_398353 | 3300042620 | Bacteria | 2070 |
| 21 | Ga0466729_135755 | 3300042621 | Bacteria | 9679 |
| 22 | 2227072440 | 2225789003 | Bacteria | 13102 |
| 23 | 2227474342 | 2225789004 | Bacteria | 4724 |
| 24 | JGI24702J35022_10026334 | 3300002462 | Bacteria | 3133 |
| 25 | JGI24699J35502_11134157 | 3300002509 | Bacteria | 40557 |
| 26 | Ga0123357_10003501 | 3300009784 | Bacteria | 18049 |
| 27 | Ga0466701_053913 | 3300042598 | Bacteria | 7349 |
| 28 | Ga0466706_260080 | 3300042599 | Bacteria | 1433 |
| 29 | Ga0466700_115552 | 3300042600 | Bacteria | 26876 |
| 30 | Ga0466707_271224 | 3300042601 | Bacteria | 9147 |
| 31 | Ga0466719_494120 | 3300042606 | Bacteria | 8489 |
| 32 | Ga0123357_10010939 | 3300009784 | Bacteria | 11585 |
| 33 | Ga0123357_10036964 | 3300009784 | Bacteria | 6645 |
| 34 | Ga0123354_10006263 | 3300010882 | Bacteria | 17632 |
| 35 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 36 | Ga0466729_205396 | 3300042621 | Bacteria | 3342 |
| 37 | Ga0466735_085612 | 3300042624 | Bacteria | 2895 |
| 38 | Ga0466735_214834 | 3300042624 | Bacteria | 4283 |
| 39 | Ga0466735_232566 | 3300042624 | Bacteria | 1422 |
| 40 | Ga0466703_033925 | 3300042636 | Bacteria | 2073 |
| 41 | Ga0466704_342826 | 3300042643 | Bacteria | 7865 |
| 42 | Ga0466704_458103 | 3300042643 | Bacteria | 1213 |
| 43 | Ga0466699_147168 | 3300042597 | Bacteria | 6708 |
| 44 | Ga0466711_222138 | 3300042615 | Bacteria | 34260 |
| 45 | Ga0466715_006491 | 3300042616 | Bacteria | 11353 |
| 46 | Ga0466728_109323 | 3300042620 | Bacteria | 29533 |
| 47 | Ga0466728_128512 | 3300042620 | Bacteria | 23920 |
| 48 | IMNBL1DRAFT_c0000888 | 3300000062 | Bacteria | 23268 |
| 49 | IMNBL1DRAFT_c0001493 | 3300000062 | Bacteria | 17437 |
| 50 | IMNBL1DRAFT_c0001604 | 3300000062 | Bacteria | 16784 |
| 51 | JGI24702J35022_10010884 | 3300002462 | Bacteria | 5075 |
| 52 | JGI24702J35022_10208905 | 3300002462 | Bacteria | 1120 |
| 53 | JGI24705J35276_12092546 | 3300002504 | Bacteria | 998 |
| 54 | JGI24705J35276_12200381 | 3300002504 | Bacteria | 1601 |
| 55 | JGI24699J35502_11133869 | 3300002509 | Bacteria | 17597 |
| 56 | Ga0068302_10227837 | 3300005071 | Bacteria | 5498 |
| 57 | Ga0466707_018219 | 3300042601 | Bacteria | 12288 |
| 58 | Ga0466707_254503 | 3300042601 | Bacteria | 6599 |
| 59 | Ga0466713_049079 | 3300042602 | Bacteria | 4529 |
| 60 | Ga0466716_278312 | 3300042605 | Bacteria | 3847 |
| 61 | Ga0466722_093567 | 3300042609 | Bacteria | 6385 |
| 62 | Ga0466722_094026 | 3300042609 | Bacteria | 13311 |
| 63 | Ga0123357_10022969 | 3300009784 | Bacteria | 8371 |
| 64 | Ga0123357_10401724 | 3300009784 | Bacteria | 1246 |
| 65 | Ga0466704_192038 | 3300042643 | Bacteria | 6378 |
| 66 | Ga0466708_031780 | 3300042652 | Bacteria | 13567 |
| 67 | Ga0466725_160865 | 3300042654 | Bacteria | 5721 |
| 68 | Ga0466690_017517 | 3300042590 | Bacteria | 22678 |
| 69 | Ga0466692_147406 | 3300042591 | Bacteria | 6178 |
| 70 | Ga0466694_199834 | 3300042594 | Bacteria | 2670 |
| 71 | Ga0466696_333016 | 3300042596 | Bacteria | 3966 |
| 72 | Ga0466711_236413 | 3300042615 | Bacteria | 6587 |
| 73 | Ga0466723_231997 | 3300042618 | Bacteria | 12187 |
| 74 | Ga0466728_267319 | 3300042620 | Bacteria | 36275 |
| 75 | Ga0466707_056811 | 3300042601 | Bacteria | 7083 |
| 76 | Ga0466707_395101 | 3300042601 | Bacteria | 2156 |
| 77 | Ga0466713_068672 | 3300042602 | Bacteria | 133468 |
| 78 | Ga0466716_020808 | 3300042605 | Bacteria | 1257 |
| 79 | Ga0466716_197148 | 3300042605 | Bacteria | 3798 |
| 80 | Ga0466719_161072 | 3300042606 | Bacteria | 2803 |
| 81 | Ga0466719_368693 | 3300042606 | Bacteria | 8795 |
| 82 | Ga0466722_077297 | 3300042609 | Bacteria | 12633 |
| 83 | Ga0123357_10003895 | 3300009784 | Bacteria | 17318 |
| 84 | Ga0123354_10131301 | 3300010882 | Bacteria | 3162 |
| 85 | Ga0466703_030205 | 3300042636 | Bacteria | 6649 |
| 86 | Ga0466703_067681 | 3300042636 | Bacteria | 6109 |
| 87 | Ga0466704_037901 | 3300042643 | Bacteria | 18687 |
| 88 | Ga0466727_241532 | 3300042655 | Bacteria | 2957 |
| 89 | Ga0466690_296510 | 3300042590 | Bacteria | 22089 |
| 90 | Ga0466692_157590 | 3300042591 | Bacteria | 38629 |
| 91 | Ga0466705_320045 | 3300042612 | Bacteria | 5232 |
| 92 | Ga0466711_086368 | 3300042615 | Bacteria | 13336 |
| 93 | Ga0466715_127650 | 3300042616 | Bacteria | 20292 |
| 94 | Ga0466715_172001 | 3300042616 | Bacteria | 21115 |
| 95 | Ga0466726_442562 | 3300042619 | Bacteria | 24934 |
| 96 | Ga0466728_432805 | 3300042620 | Bacteria | 1432 |
| 97 | 2227450250 | 2225789004 | Unclassified | 5425 |
| 98 | 2227467416 | 2225789004 | Bacteria | 5073 |
| 99 | JGI24695J34938_10071875 | 3300002450 | Bacteria | 1444 |
| 100 | Ga0123357_10000562 | 3300009784 | Bacteria | 36621 |
| 101 | Ga0466700_154339 | 3300042600 | Bacteria | 2063 |
| 102 | Ga0466716_054306 | 3300042605 | Bacteria | 5565 |
| 103 | Ga0123357_10241058 | 3300009784 | Bacteria | 1958 |
| 104 | Ga0123356_10880786 | 3300010049 | Bacteria | 1066 |
| 105 | Ga0123354_10006992 | 3300010882 | Bacteria | 16870 |
| 106 | Ga0123354_10052158 | 3300010882 | Bacteria | 6165 |
| 107 | Ga0466735_153690 | 3300042624 | Bacteria | 1096 |
| 108 | Ga0466704_136900 | 3300042643 | Bacteria | 8133 |
| 109 | Ga0466704_170080 | 3300042643 | Bacteria | 45113 |
| 110 | Ga0466727_169478 | 3300042655 | Bacteria | 3320 |
| 111 | Ga0466690_169035 | 3300042590 | Bacteria | 8286 |
| 112 | Ga0466692_076121 | 3300042591 | Bacteria | 39976 |
| 113 | Ga0466696_398566 | 3300042596 | Bacteria | 10191 |
| 114 | Ga0466701_015645 | 3300042598 | Bacteria | 10177 |
| 115 | Ga0466705_016778 | 3300042612 | Bacteria | 7761 |
| 116 | Ga0466705_342178 | 3300042612 | Bacteria | 42153 |
| 117 | Ga0466715_187702 | 3300042616 | Bacteria | 5301 |
| 118 | Ga0466728_324686 | 3300042620 | Bacteria | 4445 |
| 119 | 2227560735 | 2225789004 | Bacteria | 14480 |
| 120 | IMNBL1DRAFT_c0000013 | 3300000062 | Bacteria | 180832 |
| 121 | IMNBL1DRAFT_c0006815 | 3300000062 | Bacteria | 6154 |
| 122 | Ga0466707_018443 | 3300042601 | Bacteria | 12796 |
| 123 | Ga0466713_033020 | 3300042602 | Bacteria | 4539 |
| 124 | Ga0466713_146312 | 3300042602 | Bacteria | 2211 |
| 125 | Ga0466719_515918 | 3300042606 | Bacteria | 12958 |
| 126 | Ga0123354_10007441 | 3300010882 | Bacteria | 16489 |
| 127 | Ga0123354_10020461 | 3300010882 | Bacteria | 10410 |
| 128 | Ga0123354_10155911 | 3300010882 | Bacteria | 2739 |
| 129 | Ga0466733_110309 | 3300042659 | Bacteria | 6828 |
| 130 | Ga0466729_281255 | 3300042621 | Bacteria | 2041 |
| 131 | Ga0466734_159763 | 3300042623 | Bacteria | 1472 |
| 132 | Ga0466735_056602 | 3300042624 | Bacteria | 2990 |
| 133 | Ga0466708_233940 | 3300042652 | Bacteria | 9713 |
| 134 | Ga0466727_219343 | 3300042655 | Bacteria | 4173 |
| 135 | Ga0466693_041412 | 3300042592 | Bacteria | 1669 |
| 136 | Ga0466691_006494 | 3300042593 | Bacteria | 13020 |
| 137 | Ga0466728_246698 | 3300042620 | Bacteria | 1318 |
| 138 | 2227626313 | 2225789004 | Bacteria | 2152 |
| 139 | JGI24699J35502_11134209 | 3300002509 | Bacteria | 59622 |
| 140 | JGI24696J40584_12960435 | 3300002834 | Bacteria | 7230 |
| 141 | Ga0466700_093178 | 3300042600 | Bacteria | 6227 |
| 142 | Ga0466713_058280 | 3300042602 | Bacteria | 24824 |
| 143 | Ga0466719_025880 | 3300042606 | Bacteria | 2896 |
| 144 | Ga0466719_302108 | 3300042606 | Bacteria | 2582 |
| 145 | Ga0123357_10006248 | 3300009784 | Bacteria | 14478 |
| 146 | Ga0123353_10026616 | 3300010167 | Bacteria | 8841 |
| 147 | Ga0123353_10055791 | 3300010167 | Bacteria | 6322 |
| 148 | Ga0466733_049019 | 3300042659 | Bacteria | 34247 |
| 149 | Ga0466734_082022 | 3300042623 | Bacteria | 1245 |
| 150 | Ga0466735_090008 | 3300042624 | Bacteria | 5695 |
| 151 | Ga0466735_107145 | 3300042624 | Bacteria | 11894 |
| 152 | Ga0466703_048088 | 3300042636 | Bacteria | 40180 |
| 153 | Ga0466703_223832 | 3300042636 | Bacteria | 6905 |
| 154 | Ga0466703_320358 | 3300042636 | Bacteria | 44545 |
| 155 | Ga0466704_023620 | 3300042643 | Bacteria | 4292 |
| 156 | Ga0466704_259836 | 3300042643 | Bacteria | 5954 |
| 157 | Ga0466709_052166 | 3300042648 | Bacteria | 30375 |
| 158 | Ga0466725_317005 | 3300042654 | Bacteria | 23315 |
| 159 | Ga0466727_116386 | 3300042655 | Bacteria | 8479 |
| 160 | Ga0466690_119681 | 3300042590 | Bacteria | 18648 |
| 161 | Ga0466692_202977 | 3300042591 | Bacteria | 25725 |
| 162 | Ga0466715_022831 | 3300042616 | Bacteria | 11871 |
| 163 | Ga0466728_338284 | 3300042620 | Bacteria | 92891 |
| 164 | 2227422476 | 2225789004 | Bacteria | 5620 |
| 165 | Ga0068305_10171143 | 3300005083 | Bacteria | 3163 |
| 166 | Ga0068305_10460416 | 3300005083 | Bacteria | 1762 |
| 167 | Ga0466716_241806 | 3300042605 | Bacteria | 2649 |
| 168 | Ga0466722_143944 | 3300042609 | Bacteria | 23666 |
| 169 | Ga0466722_252821 | 3300042609 | Bacteria | 235840 |
| 170 | Ga0466697_007298 | 3300042611 | Bacteria | 1776 |
| 171 | Ga0123357_10037229 | 3300009784 | Bacteria | 6620 |
| 172 | Ga0123357_10039121 | 3300009784 | Bacteria | 6459 |
| 173 | Ga0123354_10002273 | 3300010882 | Bacteria | 25118 |
| 174 | Ga0466735_016838 | 3300042624 | Bacteria | 28411 |
| 175 | Ga0466735_229986 | 3300042624 | Bacteria | 3504 |
| 176 | Ga0466703_396203 | 3300042636 | Bacteria | 3223 |
| 177 | Ga0466690_083768 | 3300042590 | Bacteria | 25653 |
| 178 | Ga0466690_337300 | 3300042590 | Bacteria | 19939 |
| 179 | Ga0466692_086870 | 3300042591 | Bacteria | 4509 |
| 180 | Ga0466691_181414 | 3300042593 | Bacteria | 4157 |
| 181 | Ga0466705_005625 | 3300042612 | Bacteria | 36078 |
| 182 | Ga0466705_491715 | 3300042612 | Bacteria | 12471 |
| 183 | Ga0466718_152551 | 3300042617 | Bacteria | 1756 |
| 184 | Ga0466726_057843 | 3300042619 | Bacteria | 10697 |
| 185 | JGI24699J35502_11134064 | 3300002509 | Bacteria | 27953 |
| 186 | Ga0466706_203102 | 3300042599 | Bacteria | 35690 |
| 187 | Ga0466700_054125 | 3300042600 | Bacteria | 6945 |
| 188 | Ga0466700_491849 | 3300042600 | Bacteria | 1441 |
| 189 | Ga0466707_106749 | 3300042601 | Bacteria | 20341 |
| 190 | Ga0466707_200784 | 3300042601 | Bacteria | 7523 |
| 191 | Ga0466707_371599 | 3300042601 | Bacteria | 2877 |
| 192 | Ga0466719_434400 | 3300042606 | Bacteria | 1114 |
| 193 | Ga0466722_148628 | 3300042609 | Bacteria | 32360 |
| 194 | Ga0466722_197521 | 3300042609 | Bacteria | 3270 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01509 | GO:0006396 | RNA processing | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.