Protein Family IF09457
Metagenome
Isolate
159
Members
58
Samples
145
Scaffolds
226.69
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_293750|Ga0466704_293750_137_925
- Length
- 262 aa
- Sequence
- MRCVLAGIMVWHGFGTYNGINNRAPLLRAPEKIENIMIKIENLKKVFRTEEVETVALNEVSLEVNRSEFIAVMGPSGCGKSTLLNILGLLDNPTAGTYHLAEQEVGHLKEKDRTQARKGNIGFVFQSFNLIEEMSVFENVELPLVYMKVGKAERRLRVDEALKRMSISHRAKHFPNQLSGGQQQRVAIARAVVSNPKIILADEPTGNLDSKNGRDVMDLLSELNREGTTIVMVTHSQHDASFAHRIINLFDGQIVTEVQSRM
Sample Types
Isolate
8.8%
Metagenome
91.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.2%
Kalotermitidae
22.4%
Blattidae
12.1%
Unclassified
8.6%
Rhinotermitidae
6.9%
Termopsidae
5.2%
Hydrophilidae
3.4%
Passalidae
3.4%
Hodotermitidae
1.7%
Taxonomy
Archaea
0
Bacteria
135
Eukaryota
0
Viruses
0
Unclassified
24
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 2 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 13 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 14 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 15 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 16 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 17 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 18 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 21 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 22 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 23 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 24 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 25 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 28 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 29 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 30 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 31 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 32 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 33 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 34 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 35 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 36 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 37 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 38 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 39 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 40 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 41 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 42 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 43 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 45 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 46 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 47 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 48 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 49 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 50 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 51 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 52 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 53 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 54 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 55 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 56 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 57 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 58 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_205326 | 3300042612 | Bacteria | 5933 |
| 2 | Ga0466705_228204 | 3300042612 | Bacteria | 8413 |
| 3 | Ga0466707_175751 | 3300042601 | Bacteria | 1991 |
| 4 | Ga0466713_136308 | 3300042602 | Bacteria | 60881 |
| 5 | Ga0466714_026670 | 3300042603 | Unclassified | 15441 |
| 6 | Ga0466714_083935 | 3300042603 | Unclassified | 9653 |
| 7 | Ga0466714_147952 | 3300042603 | Bacteria | 5594 |
| 8 | Ga0466716_320508 | 3300042605 | Bacteria | 7064 |
| 9 | Ga0466729_266211 | 3300042621 | Unclassified | 2964 |
| 10 | Ga0123357_10061808 | 3300009784 | Unclassified | 5018 |
| 11 | Ga0123357_10103289 | 3300009784 | Bacteria | 3666 |
| 12 | Ga0123356_10590674 | 3300010049 | Bacteria | 1274 |
| 13 | Ga0123354_10093302 | 3300010882 | Bacteria | 4139 |
| 14 | Ga0466710_203831 | 3300042613 | Bacteria | 1643 |
| 15 | Ga0466711_294920 | 3300042615 | Bacteria | 4911 |
| 16 | Ga0466694_134428 | 3300042594 | Bacteria | 1005 |
| 17 | Ga0466694_359347 | 3300042594 | Bacteria | 2004 |
| 18 | JGI24705J35276_12047795 | 3300002504 | Unclassified | 913 |
| 19 | JGI24699J35502_10967692 | 3300002509 | Bacteria | 1225 |
| 20 | JGI24699J35502_11133772 | 3300002509 | Bacteria | 15223 |
| 21 | Ga0466701_016636 | 3300042598 | Bacteria | 1501 |
| 22 | Ga0466714_068028 | 3300042603 | Unclassified | 2218 |
| 23 | Ga0466714_097034 | 3300042603 | Bacteria | 3543 |
| 24 | Ga0466714_150527 | 3300042603 | Bacteria | 4002 |
| 25 | Ga0466716_437183 | 3300042605 | Bacteria | 31064 |
| 26 | Ga0466735_009089 | 3300042624 | Bacteria | 8225 |
| 27 | Ga0466703_047686 | 3300042636 | Bacteria | 11689 |
| 28 | Ga0466704_062392 | 3300042643 | Bacteria | 22291 |
| 29 | Ga0123356_10616457 | 3300010049 | Bacteria | 1250 |
| 30 | Ga0123353_10094917 | 3300010167 | Unclassified | 4805 |
| 31 | Ga0123354_10086928 | 3300010882 | Unclassified | 4366 |
| 32 | Ga0466690_206376 | 3300042590 | Bacteria | 31826 |
| 33 | Ga0466690_385612 | 3300042590 | Bacteria | 8468 |
| 34 | Ga0466693_249152 | 3300042592 | Bacteria | 1080 |
| 35 | Ga0466694_166494 | 3300042594 | Bacteria | 3875 |
| 36 | Ga0466701_006557 | 3300042598 | Bacteria | 5726 |
| 37 | IMNBL1DRAFT_c0011546 | 3300000062 | Bacteria | 4117 |
| 38 | Ga0466697_199531 | 3300042611 | Bacteria | 1507 |
| 39 | Ga0466733_167796 | 3300042659 | Bacteria | 7257 |
| 40 | Ga0466701_075588 | 3300042598 | Unclassified | 4922 |
| 41 | Ga0466707_412331 | 3300042601 | Unclassified | 7486 |
| 42 | Ga0466713_091714 | 3300042602 | Bacteria | 189911 |
| 43 | Ga0466714_052845 | 3300042603 | Bacteria | 5510 |
| 44 | Ga0466714_069805 | 3300042603 | Bacteria | 22687 |
| 45 | Ga0466714_132509 | 3300042603 | Bacteria | 2651 |
| 46 | Ga0466734_145094 | 3300042623 | Bacteria | 1366 |
| 47 | Ga0466735_074129 | 3300042624 | Bacteria | 1151 |
| 48 | Ga0466735_189042 | 3300042624 | Bacteria | 4105 |
| 49 | Ga0466703_243185 | 3300042636 | Bacteria | 1717 |
| 50 | Ga0466727_017548 | 3300042655 | Bacteria | 9569 |
| 51 | Ga0123357_10009380 | 3300009784 | Bacteria | 12353 |
| 52 | Ga0123356_10017159 | 3300010049 | Bacteria | 6890 |
| 53 | Ga0466715_096433 | 3300042616 | Bacteria | 41816 |
| 54 | Ga0466723_141338 | 3300042618 | Bacteria | 4626 |
| 55 | Ga0466723_251209 | 3300042618 | Bacteria | 2472 |
| 56 | Ga0466692_193704 | 3300042591 | Bacteria | 3450 |
| 57 | Ga0466693_326124 | 3300042592 | Bacteria | 4006 |
| 58 | JGI24696J40584_12862979 | 3300002834 | Bacteria | 1018 |
| 59 | Ga0466700_074861 | 3300042600 | Unclassified | 4834 |
| 60 | Ga0466707_273341 | 3300042601 | Bacteria | 1110 |
| 61 | Ga0466714_081893 | 3300042603 | Bacteria | 9910 |
| 62 | Ga0466719_133309 | 3300042606 | Bacteria | 5824 |
| 63 | Ga0466703_180370 | 3300042636 | Bacteria | 2986 |
| 64 | Ga0466709_219154 | 3300042648 | Bacteria | 176728 |
| 65 | Ga0123357_10063051 | 3300009784 | Bacteria | 4958 |
| 66 | Ga0123353_10011026 | 3300010167 | Bacteria | 12690 |
| 67 | Ga0123354_10338399 | 3300010882 | Bacteria | 1360 |
| 68 | Ga0466728_158036 | 3300042620 | Bacteria | 2503 |
| 69 | Ga0466729_073949 | 3300042621 | Bacteria | 13137 |
| 70 | Ga0466691_067133 | 3300042593 | Bacteria | 4212 |
| 71 | Ga0466696_207440 | 3300042596 | Bacteria | 1732 |
| 72 | JGI24702J35022_10269292 | 3300002462 | Bacteria | 996 |
| 73 | Ga0466705_039414 | 3300042612 | Unclassified | 1730 |
| 74 | Ga0466733_141982 | 3300042659 | Unclassified | 1472 |
| 75 | Ga0466733_175131 | 3300042659 | Bacteria | 24781 |
| 76 | Ga0466707_008477 | 3300042601 | Bacteria | 11214 |
| 77 | Ga0466707_393526 | 3300042601 | Bacteria | 7714 |
| 78 | Ga0466714_012557 | 3300042603 | Bacteria | 1614 |
| 79 | Ga0466714_038452 | 3300042603 | Unclassified | 1187 |
| 80 | Ga0466703_381185 | 3300042636 | Bacteria | 1206 |
| 81 | Ga0466704_583464 | 3300042643 | Bacteria | 34188 |
| 82 | Ga0466727_153541 | 3300042655 | Unclassified | 9458 |
| 83 | Ga0123357_10106891 | 3300009784 | Bacteria | 3585 |
| 84 | Ga0123356_10295505 | 3300010049 | Bacteria | 1722 |
| 85 | Ga0123354_10435941 | 3300010882 | Unclassified | 1075 |
| 86 | Ga0123354_10456567 | 3300010882 | Unclassified | 1030 |
| 87 | Ga0466710_186551 | 3300042613 | Bacteria | 4586 |
| 88 | Ga0466715_425730 | 3300042616 | Bacteria | 12959 |
| 89 | Ga0466718_089107 | 3300042617 | Bacteria | 1200 |
| 90 | Ga0466690_128755 | 3300042590 | Bacteria | 5908 |
| 91 | Ga0466690_138026 | 3300042590 | Bacteria | 33660 |
| 92 | Ga0466692_166395 | 3300042591 | Bacteria | 3685 |
| 93 | Ga0466694_142711 | 3300042594 | Bacteria | 1066 |
| 94 | Ga0466696_013622 | 3300042596 | Bacteria | 5850 |
| 95 | Ga0466696_220752 | 3300042596 | Bacteria | 21180 |
| 96 | IMNBL1DRAFT_c0024389 | 3300000062 | Bacteria | 2346 |
| 97 | JGI24702J35022_10035011 | 3300002462 | Bacteria | 2686 |
| 98 | JGI24702J35022_10051268 | 3300002462 | Bacteria | 2199 |
| 99 | Ga0466705_152205 | 3300042612 | Bacteria | 1037 |
| 100 | Ga0466733_211697 | 3300042659 | Bacteria | 5503 |
| 101 | Ga0466707_324535 | 3300042601 | Bacteria | 1038 |
| 102 | Ga0466714_132007 | 3300042603 | Bacteria | 2273 |
| 103 | Ga0466714_158324 | 3300042603 | Bacteria | 1134 |
| 104 | Ga0466704_293750 | 3300042643 | Bacteria | 1288 |
| 105 | Ga0466709_136530 | 3300042648 | Bacteria | 9010 |
| 106 | Ga0466709_176022 | 3300042648 | Unclassified | 5584 |
| 107 | Ga0466725_358148 | 3300042654 | Bacteria | 1186 |
| 108 | Ga0123354_10010911 | 3300010882 | Bacteria | 14018 |
| 109 | Ga0466715_162401 | 3300042616 | Bacteria | 1324 |
| 110 | JGI24705J35276_12233267 | 3300002504 | Bacteria | 4753 |
| 111 | Ga0466697_269670 | 3300042611 | Bacteria | 2782 |
| 112 | Ga0466733_011388 | 3300042659 | Bacteria | 6499 |
| 113 | Ga0466706_280232 | 3300042599 | Bacteria | 1303 |
| 114 | Ga0466700_358694 | 3300042600 | Bacteria | 9134 |
| 115 | Ga0466707_302696 | 3300042601 | Bacteria | 10116 |
| 116 | Ga0466719_120115 | 3300042606 | Bacteria | 6686 |
| 117 | Ga0466729_216498 | 3300042621 | Unclassified | 2993 |
| 118 | Ga0466729_263652 | 3300042621 | Bacteria | 15570 |
| 119 | Ga0466735_192481 | 3300042624 | Unclassified | 2544 |
| 120 | Ga0466704_568888 | 3300042643 | Bacteria | 3152 |
| 121 | Ga0466709_285715 | 3300042648 | Bacteria | 24593 |
| 122 | Ga0466727_089068 | 3300042655 | Bacteria | 9947 |
| 123 | Ga0466710_112995 | 3300042613 | Bacteria | 1607 |
| 124 | Ga0466726_072057 | 3300042619 | Bacteria | 16625 |
| 125 | Ga0466729_082905 | 3300042621 | Bacteria | 5844 |
| 126 | Ga0466694_377022 | 3300042594 | Bacteria | 1103 |
| 127 | Ga0466696_050605 | 3300042596 | Bacteria | 8934 |
| 128 | IMNBL1DRAFT_c0002265 | 3300000062 | Bacteria | 13543 |
| 129 | Ga0466705_019993 | 3300042612 | Bacteria | 19075 |
| 130 | Ga0466705_158704 | 3300042612 | Bacteria | 10601 |
| 131 | Ga0466705_314443 | 3300042612 | Unclassified | 4279 |
| 132 | Ga0466733_115294 | 3300042659 | Bacteria | 114356 |
| 133 | Ga0466701_039358 | 3300042598 | Bacteria | 2951 |
| 134 | Ga0466706_263700 | 3300042599 | Bacteria | 15446 |
| 135 | Ga0466714_007361 | 3300042603 | Unclassified | 6184 |
| 136 | Ga0466714_025607 | 3300042603 | Bacteria | 4774 |
| 137 | Ga0466714_108048 | 3300042603 | Unclassified | 1828 |
| 138 | Ga0466719_063766 | 3300042606 | Bacteria | 5343 |
| 139 | Ga0123356_10927894 | 3300010049 | Bacteria | 1042 |
| 140 | Ga0466712_110256 | 3300042614 | Bacteria | 1157 |
| 141 | Ga0466715_245779 | 3300042616 | Bacteria | 9354 |
| 142 | Ga0466726_196707 | 3300042619 | Unclassified | 3838 |
| 143 | Ga0466657_315697 | 3300042582 | Bacteria | 1022 |
| 144 | 2227563519 | 2225789004 | Bacteria | 14404 |
| 145 | JGI24699J35502_11005196 | 3300002509 | Bacteria | 1372 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.