Protein Family IF09433
Metagenome
Isolate
181
Members
41
Samples
177
Scaffolds
291.79
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_233731|Ga0466704_233731_825_1817
- Length
- 330 aa
- Sequence
- MANGNSPENGGVEKDKTRIFSAGEPVVCGGPAAGGKYSGLSCLHTHTLFCDGHDDVETCCRRAWEKGLVSLGFSAHGPITKKTGIASDWQLPDDRLPDYLNAVRDARRRWQGKLSIYLGLEIDYIGGLMGPADRDYRDLGLDYLIGSVHYLIPPRSAPFTVDGSREELDRGLEEGFGGDGEALMHCYWDQVAAMIRSGGFDILGHADLIKKNNRPSGAAGAFFDPASPVYLQRIREIAALAGTCPGIVVEVNTGGMNRGKVSETYPSLAMLRLFRENKVPAIITADAHRAQDLDGHYGEALEVMRQAGYTETVLFEGREAGRPRWTRRGI
Sample Types
Isolate
2.2%
Metagenome
97.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
35.9%
Termitidae
33.3%
Unclassified
12.8%
Rhinotermitidae
10.3%
Termopsidae
7.7%
Taxonomy
Archaea
1
Bacteria
171
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 9 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 10 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 11 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 12 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 13 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 14 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 15 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 16 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 17 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 18 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 19 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 20 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 21 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 22 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 23 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 24 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 25 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 28 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 29 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 30 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 31 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 32 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 33 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 34 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 35 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 36 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 37 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 38 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 39 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 40 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 41 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_031229 | 3300042612 | Bacteria | 10173 |
| 2 | Ga0466716_513202 | 3300042605 | Bacteria | 6963 |
| 3 | Ga0466719_113382 | 3300042606 | Bacteria | 12353 |
| 4 | Ga0466722_001172 | 3300042609 | Bacteria | 18968 |
| 5 | Ga0466722_109046 | 3300042609 | Bacteria | 7487 |
| 6 | Ga0466715_102737 | 3300042616 | Bacteria | 2749 |
| 7 | Ga0466715_415269 | 3300042616 | Bacteria | 3988 |
| 8 | Ga0466715_422638 | 3300042616 | Bacteria | 8966 |
| 9 | Ga0466723_027465 | 3300042618 | Bacteria | 52841 |
| 10 | Ga0466723_374056 | 3300042618 | Bacteria | 12460 |
| 11 | Ga0466726_347755 | 3300042619 | Unclassified | 3414 |
| 12 | Ga0466728_087613 | 3300042620 | Bacteria | 22622 |
| 13 | Ga0466735_060096 | 3300042624 | Bacteria | 10662 |
| 14 | Ga0466704_107317 | 3300042643 | Bacteria | 16066 |
| 15 | Ga0466708_005041 | 3300042652 | Bacteria | 6627 |
| 16 | Ga0466727_296765 | 3300042655 | Bacteria | 12142 |
| 17 | Ga0074263_112990 | 3300005485 | Bacteria | 1632 |
| 18 | Ga0466690_158526 | 3300042590 | Unclassified | 6516 |
| 19 | Ga0466696_126161 | 3300042596 | Bacteria | 18379 |
| 20 | Ga0466732_047170 | 3300042656 | Bacteria | 4337 |
| 21 | Ga0466732_054799 | 3300042656 | Bacteria | 38151 |
| 22 | Ga0466707_418922 | 3300042601 | Bacteria | 2830 |
| 23 | Ga0466722_247065 | 3300042609 | Bacteria | 5362 |
| 24 | Ga0466712_198456 | 3300042614 | Bacteria | 11385 |
| 25 | Ga0466711_118907 | 3300042615 | Bacteria | 22300 |
| 26 | Ga0466718_078722 | 3300042617 | Unclassified | 23078 |
| 27 | Ga0466728_035113 | 3300042620 | Bacteria | 18880 |
| 28 | Ga0466703_359344 | 3300042636 | Bacteria | 5556 |
| 29 | Ga0466704_273263 | 3300042643 | Bacteria | 3750 |
| 30 | Ga0466708_110505 | 3300042652 | Bacteria | 22257 |
| 31 | Ga0466708_119401 | 3300042652 | Bacteria | 8220 |
| 32 | Ga0466708_391978 | 3300042652 | Bacteria | 2290 |
| 33 | Ga0264413_100942 | 3300024493 | Bacteria | 33361 |
| 34 | Ga0466690_026753 | 3300042590 | Bacteria | 1415 |
| 35 | Ga0466692_110776 | 3300042591 | Bacteria | 4073 |
| 36 | Ga0466691_126502 | 3300042593 | Bacteria | 2053 |
| 37 | Ga0466694_325414 | 3300042594 | Bacteria | 2339 |
| 38 | Ga0466732_108286 | 3300042656 | Bacteria | 14022 |
| 39 | Ga0466716_342927 | 3300042605 | Bacteria | 11324 |
| 40 | Ga0466719_149251 | 3300042606 | Bacteria | 30373 |
| 41 | Ga0466722_116002 | 3300042609 | Bacteria | 2454 |
| 42 | Ga0466722_261935 | 3300042609 | Bacteria | 7802 |
| 43 | Ga0466712_211411 | 3300042614 | Bacteria | 17917 |
| 44 | Ga0466715_063207 | 3300042616 | Bacteria | 4416 |
| 45 | Ga0466715_228874 | 3300042616 | Bacteria | 1742 |
| 46 | Ga0466715_594364 | 3300042616 | Bacteria | 2630 |
| 47 | Ga0466718_086826 | 3300042617 | Bacteria | 4933 |
| 48 | Ga0466726_068684 | 3300042619 | Bacteria | 3632 |
| 49 | Ga0466726_135351 | 3300042619 | Bacteria | 5605 |
| 50 | Ga0466728_017064 | 3300042620 | Bacteria | 4805 |
| 51 | Ga0123356_10003414 | 3300010049 | Bacteria | 16656 |
| 52 | Ga0466703_005643 | 3300042636 | Bacteria | 2818 |
| 53 | Ga0466703_038055 | 3300042636 | Bacteria | 21337 |
| 54 | Ga0466703_342220 | 3300042636 | Bacteria | 3813 |
| 55 | Ga0466704_089388 | 3300042643 | Bacteria | 2279 |
| 56 | Ga0466704_233731 | 3300042643 | Bacteria | 7068 |
| 57 | JGI24698J34947_10012633 | 3300002449 | Bacteria | 4626 |
| 58 | Ga0072941_1047274 | 3300005201 | Bacteria | 2799 |
| 59 | Ga0466690_050535 | 3300042590 | Bacteria | 2005 |
| 60 | Ga0466692_105690 | 3300042591 | Bacteria | 6447 |
| 61 | Ga0466691_092320 | 3300042593 | Bacteria | 15748 |
| 62 | Ga0466691_207778 | 3300042593 | Bacteria | 9459 |
| 63 | Ga0466699_039786 | 3300042597 | Bacteria | 1462 |
| 64 | Ga0466705_138121 | 3300042612 | Bacteria | 7341 |
| 65 | Ga0466716_004294 | 3300042605 | Bacteria | 7209 |
| 66 | Ga0466716_290392 | 3300042605 | Bacteria | 4966 |
| 67 | Ga0466705_426808 | 3300042612 | Bacteria | 6907 |
| 68 | Ga0466712_193522 | 3300042614 | Bacteria | 14829 |
| 69 | Ga0466711_175339 | 3300042615 | Bacteria | 20337 |
| 70 | Ga0466715_133330 | 3300042616 | Bacteria | 11129 |
| 71 | Ga0466718_146262 | 3300042617 | Bacteria | 8287 |
| 72 | Ga0466728_298072 | 3300042620 | Bacteria | 19121 |
| 73 | Ga0466703_098920 | 3300042636 | Bacteria | 2974 |
| 74 | Ga0466703_160805 | 3300042636 | Bacteria | 11268 |
| 75 | Ga0466704_468695 | 3300042643 | Bacteria | 17454 |
| 76 | AustNasuHG_c1006866 | 3300000089 | Bacteria | 4056 |
| 77 | JGI24698J34947_10010580 | 3300002449 | Bacteria | 5063 |
| 78 | Ga0072941_1007896 | 3300005201 | Bacteria | 10675 |
| 79 | Ga0466692_073526 | 3300042591 | Bacteria | 19995 |
| 80 | Ga0466691_099455 | 3300042593 | Bacteria | 1691 |
| 81 | Ga0466691_202613 | 3300042593 | Bacteria | 20551 |
| 82 | Ga0466696_178925 | 3300042596 | Bacteria | 2392 |
| 83 | Ga0466705_011203 | 3300042612 | Bacteria | 2675 |
| 84 | Ga0466707_332531 | 3300042601 | Bacteria | 2321 |
| 85 | Ga0466719_249676 | 3300042606 | Unclassified | 6311 |
| 86 | Ga0466719_452615 | 3300042606 | Bacteria | 20917 |
| 87 | Ga0466720_028247 | 3300042607 | Bacteria | 17929 |
| 88 | Ga0466720_138607 | 3300042607 | Bacteria | 33748 |
| 89 | Ga0466722_038225 | 3300042609 | Bacteria | 7974 |
| 90 | Ga0466723_145094 | 3300042618 | Bacteria | 12073 |
| 91 | Ga0466723_247817 | 3300042618 | Bacteria | 26474 |
| 92 | Ga0123353_10481169 | 3300010167 | Bacteria | 1816 |
| 93 | Ga0466735_212263 | 3300042624 | Bacteria | 1402 |
| 94 | Ga0466703_096700 | 3300042636 | Bacteria | 3589 |
| 95 | Ga0466703_324376 | 3300042636 | Bacteria | 7747 |
| 96 | Ga0466704_112054 | 3300042643 | Bacteria | 16176 |
| 97 | Ga0466709_254544 | 3300042648 | Bacteria | 8125 |
| 98 | Ga0466709_278215 | 3300042648 | Bacteria | 14368 |
| 99 | AustNasuHG_c1000135 | 3300000089 | Bacteria | 22970 |
| 100 | JGI24698J34947_10001452 | 3300002449 | Bacteria | 12460 |
| 101 | Ga0074263_111927 | 3300005485 | Bacteria | 5443 |
| 102 | Ga0264413_100675 | 3300024493 | Bacteria | 52863 |
| 103 | Ga0466691_008888 | 3300042593 | Bacteria | 2277 |
| 104 | Ga0466696_097990 | 3300042596 | Bacteria | 29666 |
| 105 | Ga0466696_300894 | 3300042596 | Bacteria | 1179 |
| 106 | Ga0466705_054841 | 3300042612 | Bacteria | 8759 |
| 107 | Ga0466705_336359 | 3300042612 | Bacteria | 5186 |
| 108 | Ga0466732_093159 | 3300042656 | Bacteria | 2847 |
| 109 | Ga0466722_036530 | 3300042609 | Bacteria | 3446 |
| 110 | Ga0466712_320957 | 3300042614 | Bacteria | 24495 |
| 111 | Ga0466715_248326 | 3300042616 | Bacteria | 7848 |
| 112 | Ga0466715_588953 | 3300042616 | Bacteria | 3328 |
| 113 | Ga0466718_031530 | 3300042617 | Unclassified | 2443 |
| 114 | Ga0466723_273295 | 3300042618 | Bacteria | 5266 |
| 115 | Ga0466726_397832 | 3300042619 | Bacteria | 1582 |
| 116 | Ga0466729_134566 | 3300042621 | Bacteria | 1376 |
| 117 | Ga0466704_072654 | 3300042643 | Bacteria | 17069 |
| 118 | Ga0466708_040449 | 3300042652 | Bacteria | 1336 |
| 119 | Ga0466727_283272 | 3300042655 | Bacteria | 1205 |
| 120 | JGI24698J34947_10139796 | 3300002449 | Unclassified | 1022 |
| 121 | JGI24695J34938_10013821 | 3300002450 | Bacteria | 4219 |
| 122 | JGI24695J34938_10014739 | 3300002450 | Bacteria | 4037 |
| 123 | Ga0074263_100605 | 3300005485 | Bacteria | 2700 |
| 124 | Ga0264413_134437 | 3300024493 | Bacteria | 12094 |
| 125 | Ga0466690_246311 | 3300042590 | Bacteria | 8527 |
| 126 | Ga0466692_022165 | 3300042591 | Bacteria | 15406 |
| 127 | Ga0466692_028051 | 3300042591 | Bacteria | 1016 |
| 128 | Ga0466699_075117 | 3300042597 | Bacteria | 4691 |
| 129 | Ga0466707_141592 | 3300042601 | Bacteria | 3638 |
| 130 | Ga0466720_061703 | 3300042607 | Bacteria | 1081 |
| 131 | Ga0466720_133327 | 3300042607 | Bacteria | 41983 |
| 132 | Ga0466722_067559 | 3300042609 | Bacteria | 1806 |
| 133 | Ga0466711_381411 | 3300042615 | Bacteria | 37207 |
| 134 | Ga0466718_027826 | 3300042617 | Bacteria | 3929 |
| 135 | Ga0466723_064716 | 3300042618 | Bacteria | 6955 |
| 136 | Ga0466728_389092 | 3300042620 | Bacteria | 2630 |
| 137 | Ga0466728_474911 | 3300042620 | Bacteria | 2955 |
| 138 | Ga0123356_10541491 | 3300010049 | Bacteria | 1324 |
| 139 | Ga0466735_062347 | 3300042624 | Bacteria | 1086 |
| 140 | Ga0466708_187482 | 3300042652 | Bacteria | 15879 |
| 141 | Ga0466708_256750 | 3300042652 | Bacteria | 5424 |
| 142 | Ga0466727_128092 | 3300042655 | Bacteria | 4140 |
| 143 | JGI24698J34947_10038161 | 3300002449 | Unclassified | 2492 |
| 144 | JGI24698J34947_10065788 | 3300002449 | Bacteria | 1766 |
| 145 | JGI24695J34938_10000137 | 3300002450 | Bacteria | 66242 |
| 146 | Ga0072941_1020167 | 3300005201 | Bacteria | 5516 |
| 147 | Ga0072941_1037405 | 3300005201 | Bacteria | 6293 |
| 148 | Ga0072941_1149947 | 3300005201 | Bacteria | 2416 |
| 149 | Ga0456237_0014735 | 3300041968 | Bacteria | 1112 |
| 150 | Ga0466690_102157 | 3300042590 | Bacteria | 9825 |
| 151 | Ga0466690_131675 | 3300042590 | Bacteria | 9177 |
| 152 | Ga0466692_061117 | 3300042591 | Bacteria | 4092 |
| 153 | Ga0466691_035818 | 3300042593 | Bacteria | 3775 |
| 154 | Ga0466695_188911 | 3300042595 | Bacteria | 64865 |
| 155 | Ga0466696_453513 | 3300042596 | Bacteria | 1214 |
| 156 | Ga0466699_058612 | 3300042597 | Bacteria | 1805 |
| 157 | Ga0466699_184171 | 3300042597 | Bacteria | 1140 |
| 158 | Ga0466699_411165 | 3300042597 | Bacteria | 1993 |
| 159 | Ga0466705_230140 | 3300042612 | Bacteria | 10921 |
| 160 | Ga0466719_396404 | 3300042606 | Bacteria | 1496 |
| 161 | Ga0466712_020101 | 3300042614 | Unclassified | 8368 |
| 162 | Ga0466711_080435 | 3300042615 | Bacteria | 15828 |
| 163 | Ga0466718_074099 | 3300042617 | Bacteria | 7125 |
| 164 | Ga0466718_103969 | 3300042617 | Bacteria | 39674 |
| 165 | Ga0466723_216893 | 3300042618 | Bacteria | 5801 |
| 166 | Ga0466726_107331 | 3300042619 | Bacteria | 7207 |
| 167 | Ga0466728_026991 | 3300042620 | Bacteria | 3088 |
| 168 | Ga0466703_252605 | 3300042636 | Bacteria | 3599 |
| 169 | Ga0466704_019259 | 3300042643 | Bacteria | 13069 |
| 170 | Ga0466704_222516 | 3300042643 | Bacteria | 16428 |
| 171 | Ga0466708_299140 | 3300042652 | Bacteria | 2554 |
| 172 | Ga0466727_191323 | 3300042655 | Bacteria | 5877 |
| 173 | Ga0466727_218422 | 3300042655 | Archaea | 1629 |
| 174 | JGI24698J34947_10055620 | 3300002449 | Unclassified | 1970 |
| 175 | Ga0466692_093735 | 3300042591 | Bacteria | 8843 |
| 176 | Ga0466692_186034 | 3300042591 | Bacteria | 4211 |
| 177 | Ga0466694_099577 | 3300042594 | Bacteria | 97987 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02811 | PHP | PHP domain | 43 | 223 | 0.74 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02811 | GO:0003824 | catalytic activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.