Protein Family IF09430
Metagenome
Isolate
129
Members
35
Samples
120
Scaffolds
211.98
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_230455|Ga0466704_230455_605_1327
- Length
- 240 aa
- Sequence
- MKKTAPDMLPNPHEQHLKKRRTDLMANDELKYYGKIPEPTLRRLPWYLAYVKLLKGKGDSVVSSTQIAKEINVDASQVAKDLSFVNISGKTRVGYGIDALADILDSFLGFTSQHKAFLFGVGQLGAALMRDSGLNQYGVEIVAGFDIRNDVVGKEIDGIPVFPMDTLPEKQKEYGAAIGILTVPVEKAQEVTDFIIANDIKTLWNFTPFRIRVPEKVVVQNTSIYAHLAVMFNRMNENSK
Sample Types
Isolate
7.0%
Metagenome
93.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
40.0%
Blattidae
22.9%
Termopsidae
11.4%
Termitidae
8.6%
Unclassified
5.7%
Passalidae
5.7%
Hodotermitidae
2.9%
Rhinotermitidae
2.9%
Taxonomy
Archaea
0
Bacteria
127
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 5 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 11 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 12 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 13 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 14 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 15 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 16 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 17 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 18 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 19 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 20 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 21 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 22 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 23 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 24 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 25 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 26 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 27 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 28 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 29 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 30 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 31 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 32 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 35 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_078038 | 3300042612 | Bacteria | 10688 |
| 2 | Ga0466733_055799 | 3300042659 | Bacteria | 106016 |
| 3 | Ga0466691_034658 | 3300042593 | Bacteria | 6378 |
| 4 | Ga0466696_004662 | 3300042596 | Bacteria | 3206 |
| 5 | Ga0466715_359379 | 3300042616 | Bacteria | 8402 |
| 6 | Ga0466715_602785 | 3300042616 | Bacteria | 12322 |
| 7 | Ga0466723_230949 | 3300042618 | Bacteria | 4083 |
| 8 | Ga0466726_111970 | 3300042619 | Bacteria | 2388 |
| 9 | Ga0466704_251609 | 3300042643 | Bacteria | 45182 |
| 10 | Ga0466727_151974 | 3300042655 | Bacteria | 9461 |
| 11 | IMNBL1DRAFT_c0001009 | 3300000062 | Bacteria | 21721 |
| 12 | Ga0466707_050302 | 3300042601 | Bacteria | 3601 |
| 13 | Ga0123354_10114610 | 3300010882 | Bacteria | 3529 |
| 14 | Ga0466690_246577 | 3300042590 | Bacteria | 16883 |
| 15 | Ga0466691_148747 | 3300042593 | Bacteria | 15449 |
| 16 | Ga0466723_059005 | 3300042618 | Bacteria | 62633 |
| 17 | Ga0466726_362859 | 3300042619 | Bacteria | 1972 |
| 18 | Ga0466728_399396 | 3300042620 | Bacteria | 7766 |
| 19 | Ga0466735_215515 | 3300042624 | Bacteria | 3575 |
| 20 | Ga0466735_233659 | 3300042624 | Bacteria | 1540 |
| 21 | Ga0466703_202703 | 3300042636 | Bacteria | 8925 |
| 22 | Ga0466704_228006 | 3300042643 | Bacteria | 10392 |
| 23 | Ga0466708_120576 | 3300042652 | Bacteria | 34134 |
| 24 | Ga0466727_001589 | 3300042655 | Bacteria | 4634 |
| 25 | Ga0466727_197055 | 3300042655 | Bacteria | 11060 |
| 26 | Ga0466707_265105 | 3300042601 | Bacteria | 17266 |
| 27 | Ga0466705_143850 | 3300042612 | Bacteria | 38978 |
| 28 | Ga0466690_172738 | 3300042590 | Bacteria | 57212 |
| 29 | Ga0466691_020503 | 3300042593 | Bacteria | 5466 |
| 30 | Ga0466696_198573 | 3300042596 | Unclassified | 3746 |
| 31 | Ga0466696_323500 | 3300042596 | Bacteria | 24747 |
| 32 | Ga0466711_057542 | 3300042615 | Bacteria | 70908 |
| 33 | Ga0466711_277276 | 3300042615 | Bacteria | 5509 |
| 34 | Ga0466729_285797 | 3300042621 | Bacteria | 17692 |
| 35 | Ga0466735_078282 | 3300042624 | Bacteria | 1205 |
| 36 | Ga0466703_150283 | 3300042636 | Bacteria | 2603 |
| 37 | Ga0466703_165459 | 3300042636 | Bacteria | 12745 |
| 38 | Ga0466703_407045 | 3300042636 | Bacteria | 5949 |
| 39 | Ga0466709_064196 | 3300042648 | Bacteria | 3277 |
| 40 | Ga0466709_380194 | 3300042648 | Bacteria | 9690 |
| 41 | Ga0466727_265103 | 3300042655 | Bacteria | 3692 |
| 42 | 2227582948 | 2225789004 | Bacteria | 13326 |
| 43 | Ga0123357_10000910 | 3300009784 | Bacteria | 30052 |
| 44 | Ga0466716_203273 | 3300042605 | Bacteria | 2364 |
| 45 | Ga0466719_186573 | 3300042606 | Bacteria | 15608 |
| 46 | Ga0466705_025497 | 3300042612 | Bacteria | 5436 |
| 47 | Ga0466715_040385 | 3300042616 | Bacteria | 43736 |
| 48 | Ga0466723_031578 | 3300042618 | Bacteria | 25603 |
| 49 | Ga0466723_089568 | 3300042618 | Bacteria | 54083 |
| 50 | Ga0466729_287866 | 3300042621 | Bacteria | 1886 |
| 51 | IMNBL1DRAFT_c0001719 | 3300000062 | Bacteria | 16090 |
| 52 | IMNBL1DRAFT_c0003460 | 3300000062 | Bacteria | 10134 |
| 53 | Ga0068302_10519094 | 3300005071 | Bacteria | 2089 |
| 54 | Ga0466705_119312 | 3300042612 | Bacteria | 10871 |
| 55 | Ga0466690_144121 | 3300042590 | Bacteria | 19950 |
| 56 | Ga0466711_040682 | 3300042615 | Bacteria | 14896 |
| 57 | Ga0466711_211791 | 3300042615 | Bacteria | 4556 |
| 58 | Ga0466726_423872 | 3300042619 | Bacteria | 2193 |
| 59 | Ga0466703_314103 | 3300042636 | Bacteria | 9653 |
| 60 | Ga0466704_155344 | 3300042643 | Bacteria | 13326 |
| 61 | Ga0466704_230455 | 3300042643 | Bacteria | 5728 |
| 62 | Ga0466704_230588 | 3300042643 | Bacteria | 2605 |
| 63 | Ga0466709_163587 | 3300042648 | Bacteria | 2870 |
| 64 | Ga0466708_046243 | 3300042652 | Bacteria | 10646 |
| 65 | Ga0466708_173680 | 3300042652 | Bacteria | 20637 |
| 66 | Ga0466727_305508 | 3300042655 | Bacteria | 2958 |
| 67 | 2227313039 | 2225789004 | Bacteria | 1201 |
| 68 | Ga0466707_312039 | 3300042601 | Bacteria | 9254 |
| 69 | Ga0466716_390504 | 3300042605 | Bacteria | 5665 |
| 70 | Ga0466719_072882 | 3300042606 | Bacteria | 12516 |
| 71 | Ga0466705_005241 | 3300042612 | Bacteria | 8467 |
| 72 | Ga0466733_078806 | 3300042659 | Bacteria | 7143 |
| 73 | Ga0466690_037512 | 3300042590 | Bacteria | 4211 |
| 74 | Ga0466691_060692 | 3300042593 | Bacteria | 22870 |
| 75 | Ga0466696_077671 | 3300042596 | Bacteria | 18917 |
| 76 | Ga0466696_164484 | 3300042596 | Bacteria | 3472 |
| 77 | Ga0466696_321318 | 3300042596 | Bacteria | 1980 |
| 78 | Ga0466711_514103 | 3300042615 | Bacteria | 6359 |
| 79 | Ga0466715_056557 | 3300042616 | Bacteria | 7288 |
| 80 | Ga0466715_106437 | 3300042616 | Bacteria | 8386 |
| 81 | Ga0466703_202757 | 3300042636 | Bacteria | 8523 |
| 82 | Ga0466703_217268 | 3300042636 | Bacteria | 30172 |
| 83 | Ga0466703_233949 | 3300042636 | Bacteria | 12778 |
| 84 | Ga0466704_106814 | 3300042643 | Bacteria | 18291 |
| 85 | Ga0466704_282969 | 3300042643 | Bacteria | 8623 |
| 86 | Ga0466704_418711 | 3300042643 | Bacteria | 6628 |
| 87 | Ga0466706_029973 | 3300042599 | Bacteria | 5825 |
| 88 | Ga0466719_113132 | 3300042606 | Bacteria | 2524 |
| 89 | Ga0466705_233444 | 3300042612 | Bacteria | 9951 |
| 90 | Ga0466733_130571 | 3300042659 | Bacteria | 17288 |
| 91 | Ga0466690_038698 | 3300042590 | Bacteria | 19777 |
| 92 | Ga0466711_324855 | 3300042615 | Bacteria | 13815 |
| 93 | Ga0466729_226665 | 3300042621 | Bacteria | 2048 |
| 94 | Ga0466735_056066 | 3300042624 | Bacteria | 2066 |
| 95 | Ga0466703_075697 | 3300042636 | Bacteria | 9217 |
| 96 | Ga0466704_125322 | 3300042643 | Bacteria | 12471 |
| 97 | Ga0466704_341998 | 3300042643 | Unclassified | 12193 |
| 98 | Ga0466709_096536 | 3300042648 | Bacteria | 31729 |
| 99 | 2227280803 | 2225789004 | Bacteria | 6812 |
| 100 | IMNBL1DRAFT_c0011800 | 3300000062 | Bacteria | 4053 |
| 101 | Ga0466716_103220 | 3300042605 | Bacteria | 15494 |
| 102 | Ga0466716_335632 | 3300042605 | Bacteria | 16705 |
| 103 | Ga0466705_117307 | 3300042612 | Bacteria | 31530 |
| 104 | Ga0466696_071660 | 3300042596 | Bacteria | 2928 |
| 105 | Ga0466711_241851 | 3300042615 | Bacteria | 11602 |
| 106 | Ga0466715_017736 | 3300042616 | Bacteria | 12115 |
| 107 | Ga0466715_509861 | 3300042616 | Bacteria | 18242 |
| 108 | Ga0466723_199680 | 3300042618 | Bacteria | 21029 |
| 109 | Ga0466728_330389 | 3300042620 | Bacteria | 1217 |
| 110 | Ga0466728_459283 | 3300042620 | Bacteria | 2647 |
| 111 | Ga0466729_060358 | 3300042621 | Bacteria | 13859 |
| 112 | Ga0466703_098605 | 3300042636 | Bacteria | 6901 |
| 113 | IMNBL1DRAFT_c0001920 | 3300000062 | Bacteria | 15041 |
| 114 | IMNBL1DRAFT_c0030730 | 3300000062 | Bacteria | 1964 |
| 115 | Ga0068302_10229216 | 3300005071 | Bacteria | 2275 |
| 116 | Ga0466706_195384 | 3300042599 | Bacteria | 1953 |
| 117 | Ga0466707_101068 | 3300042601 | Bacteria | 3656 |
| 118 | Ga0466716_121228 | 3300042605 | Bacteria | 19334 |
| 119 | Ga0466716_297926 | 3300042605 | Bacteria | 6297 |
| 120 | Ga0466719_183090 | 3300042606 | Bacteria | 15058 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.