Protein Family IF09423
Metagenome
Isolate
111
Members
42
Samples
107
Scaffolds
80.37
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_209225|Ga0466704_209225_2327_2599
- Length
- 90 aa
- Sequence
- MQQVNIHAAKTQLSALVERAAQGEPFIIAKAGKPMVTVIPYQVLRQKTAKRVGFLKGQIKIPPNFDIDKIMEDEIIEMFYGPDGGDSRRS
Sample Types
Isolate
3.6%
Metagenome
96.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
65.0%
Kalotermitidae
15.0%
Unclassified
10.0%
Termopsidae
7.5%
Daphniidae
2.5%
Taxonomy
Archaea
0
Bacteria
92
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820132692 | Unclassified Proteobacteria Emb289P3bin76 | Isolate | Unclassified |
| 2 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 3 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 4 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 5 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 6 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 7 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 8 | 2820021908 | Unclassified Spirochaetes Lab288P4bin6 | Isolate | Unclassified |
| 9 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 10 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 11 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 12 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 13 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 14 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 15 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 16 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 17 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 18 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 19 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 20 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 23 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 24 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 27 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 28 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 29 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 30 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 31 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 32 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 33 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 34 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 35 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 36 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 37 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 38 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 39 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 40 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 41 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 42 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_308804 | 3300042601 | Bacteria | 2129 |
| 2 | Ga0123357_10398946 | 3300009784 | Bacteria | 1254 |
| 3 | Ga0123356_10180820 | 3300010049 | Bacteria | 2130 |
| 4 | Ga0123356_13287272 | 3300010049 | Bacteria | 562 |
| 5 | Ga0123353_10149101 | 3300010167 | Bacteria | 3736 |
| 6 | Ga0123353_11324786 | 3300010167 | Bacteria | 933 |
| 7 | Ga0123353_11902481 | 3300010167 | Bacteria | 734 |
| 8 | JGI24698J34947_10292408 | 3300002449 | Bacteria | 591 |
| 9 | JGI24705J35276_11543058 | 3300002504 | Unclassified | 571 |
| 10 | Ga0466731_117485 | 3300042622 | Bacteria | 1100 |
| 11 | Ga0466723_019360 | 3300042618 | Bacteria | 2373 |
| 12 | Ga0466726_359850 | 3300042619 | Bacteria | 10038 |
| 13 | Ga0415639_087454 | 3300038395 | Bacteria | 5525 |
| 14 | Ga0466694_050516 | 3300042594 | Bacteria | 1391 |
| 15 | Ga0123355_10309206 | 3300009826 | Bacteria | 2145 |
| 16 | Ga0123356_10661699 | 3300010049 | Bacteria | 1212 |
| 17 | Ga0123353_10122636 | 3300010167 | Bacteria | 4177 |
| 18 | Ga0123353_12702207 | 3300010167 | Unclassified | 584 |
| 19 | Ga0123354_10007821 | 3300010882 | Bacteria | 16185 |
| 20 | JGI24698J34947_10140428 | 3300002449 | Bacteria | 1018 |
| 21 | Ga0466709_405001 | 3300042648 | Bacteria | 1697 |
| 22 | Ga0415639_071598 | 3300038395 | Bacteria | 2453 |
| 23 | Ga0123356_13197850 | 3300010049 | Unclassified | 570 |
| 24 | Ga0123353_10003522 | 3300010167 | Bacteria | 19800 |
| 25 | Ga0123353_10621651 | 3300010167 | Unclassified | 1538 |
| 26 | Ga0123353_11620204 | 3300010167 | Bacteria | 816 |
| 27 | Ga0123353_12215717 | 3300010167 | Bacteria | 664 |
| 28 | Ga0123354_10808504 | 3300010882 | Bacteria | 630 |
| 29 | JGI24698J34947_10104834 | 3300002449 | Unclassified | 1262 |
| 30 | Ga0072940_1444683 | 3300005200 | Bacteria | 762 |
| 31 | Ga0072941_1066587 | 3300005201 | Unclassified | 1911 |
| 32 | Ga0466702_307222 | 3300042635 | Bacteria | 3734 |
| 33 | Ga0466704_114097 | 3300042643 | Unclassified | 1963 |
| 34 | Ga0466712_257006 | 3300042614 | Bacteria | 2992 |
| 35 | Ga0466718_060924 | 3300042617 | Bacteria | 1157 |
| 36 | Ga0466697_108874 | 3300042611 | Bacteria | 1352 |
| 37 | Ga0466727_351029 | 3300042655 | Bacteria | 1298 |
| 38 | Ga0466701_049828 | 3300042598 | Unclassified | 1483 |
| 39 | Ga0466707_345066 | 3300042601 | Bacteria | 1223 |
| 40 | Ga0466714_149889 | 3300042603 | Bacteria | 1908 |
| 41 | Ga0466720_080479 | 3300042607 | Bacteria | 11489 |
| 42 | Ga0123355_10156652 | 3300009826 | Bacteria | 3444 |
| 43 | Ga0123353_10000180 | 3300010167 | Bacteria | 80622 |
| 44 | Ga0123353_10600108 | 3300010167 | Bacteria | 1574 |
| 45 | Ga0123353_10870187 | 3300010167 | Bacteria | 1232 |
| 46 | Ga0123353_11133111 | 3300010167 | Bacteria | 1035 |
| 47 | Ga0123353_11519516 | 3300010167 | Bacteria | 851 |
| 48 | JGI24705J35276_11609616 | 3300002504 | Bacteria | 595 |
| 49 | Ga0072941_1015462 | 3300005201 | Bacteria | 14518 |
| 50 | Ga0466704_187496 | 3300042643 | Unclassified | 6927 |
| 51 | Ga0466727_051577 | 3300042655 | Bacteria | 1621 |
| 52 | Ga0466712_012308 | 3300042614 | Bacteria | 1528 |
| 53 | Ga0466690_136841 | 3300042590 | Bacteria | 1060 |
| 54 | Ga0466699_118926 | 3300042597 | Bacteria | 5414 |
| 55 | Ga0466705_070035 | 3300042612 | Bacteria | 55496 |
| 56 | Ga0466705_348892 | 3300042612 | Bacteria | 9006 |
| 57 | Ga0466720_013118 | 3300042607 | Bacteria | 6006 |
| 58 | Ga0123356_10056116 | 3300010049 | Bacteria | 3669 |
| 59 | Ga0123353_12344989 | 3300010167 | Unclassified | 640 |
| 60 | Ga0123353_12752427 | 3300010167 | Bacteria | 578 |
| 61 | Ga0123353_13303468 | 3300010167 | Bacteria | 514 |
| 62 | JGI24698J34947_10063319 | 3300002449 | Bacteria | 1813 |
| 63 | JGI24695J34938_10074661 | 3300002450 | Bacteria | 1410 |
| 64 | Ga0466731_204413 | 3300042622 | Bacteria | 1011 |
| 65 | Ga0466702_456271 | 3300042635 | Unclassified | 1234 |
| 66 | Ga0466712_014291 | 3300042614 | Unclassified | 1963 |
| 67 | Ga0466718_013494 | 3300042617 | Bacteria | 9781 |
| 68 | Ga0264413_141473 | 3300024493 | Unclassified | 1606 |
| 69 | Ga0466656_214906 | 3300042550 | Bacteria | 1140 |
| 70 | Ga0466714_001763 | 3300042603 | Bacteria | 1078 |
| 71 | Ga0466714_107781 | 3300042603 | Bacteria | 1874 |
| 72 | Ga0123355_10927938 | 3300009826 | Bacteria | 940 |
| 73 | Ga0123356_13930693 | 3300010049 | Bacteria | 512 |
| 74 | Ga0072941_1025711 | 3300005201 | Bacteria | 3808 |
| 75 | Ga0466704_091271 | 3300042643 | Bacteria | 2964 |
| 76 | Ga0466704_209225 | 3300042643 | Bacteria | 2641 |
| 77 | Ga0466726_326927 | 3300042619 | Bacteria | 1138 |
| 78 | Ga0415639_038638 | 3300038395 | Unclassified | 1970 |
| 79 | Ga0415639_250748 | 3300038395 | Unclassified | 2189 |
| 80 | Ga0466699_129361 | 3300042597 | Bacteria | 1055 |
| 81 | Ga0466733_208429 | 3300042659 | Bacteria | 1264 |
| 82 | Ga0466707_394843 | 3300042601 | Bacteria | 4986 |
| 83 | Ga0123356_10054531 | 3300010049 | Bacteria | 3723 |
| 84 | Ga0123353_10103056 | 3300010167 | Bacteria | 4599 |
| 85 | Ga0123353_11014032 | 3300010167 | Bacteria | 1114 |
| 86 | Ga0123353_11412314 | 3300010167 | Bacteria | 894 |
| 87 | Ga0123353_13018236 | 3300010167 | Bacteria | 545 |
| 88 | Nasutiter_FTJKGMZ01CF6IS | 2030936001 | Bacteria | 511 |
| 89 | JGI24698J34947_10084796 | 3300002449 | Unclassified | 1474 |
| 90 | JGI24696J40584_12694684 | 3300002834 | Bacteria | 732 |
| 91 | Ga0072940_1011785 | 3300005200 | Bacteria | 3650 |
| 92 | Ga0466731_173177 | 3300042622 | Bacteria | 1446 |
| 93 | Ga0466712_059405 | 3300042614 | Bacteria | 5082 |
| 94 | Ga0415639_017048 | 3300038395 | Unclassified | 7431 |
| 95 | Ga0466699_009592 | 3300042597 | Bacteria | 2643 |
| 96 | Ga0466707_402935 | 3300042601 | Bacteria | 3026 |
| 97 | Ga0466719_319074 | 3300042606 | Bacteria | 1201 |
| 98 | Ga0123353_10373358 | 3300010167 | Unclassified | 2137 |
| 99 | Ga0123353_11048056 | 3300010167 | Bacteria | 1090 |
| 100 | Ga0123353_11185470 | 3300010167 | Bacteria | 1004 |
| 101 | Ga0123353_13163370 | 3300010167 | Bacteria | 529 |
| 102 | JGI24698J34947_10150378 | 3300002449 | Bacteria | 968 |
| 103 | Ga0068302_10129650 | 3300005071 | Unclassified | 2662 |
| 104 | Ga0466734_167665 | 3300042623 | Bacteria | 1234 |
| 105 | Ga0466712_037523 | 3300042614 | Bacteria | 1145 |
| 106 | Ga0466726_176750 | 3300042619 | Bacteria | 2906 |
| 107 | Ga0466693_381940 | 3300042592 | Bacteria | 1196 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042619 | Ga0466726_176750 | Ga0466726_176750_670_885 | 71 |
| 2 | 3300042603 | Ga0466714_107781 | Ga0466714_107781_1222_1452 | 76 |
| 3 | 3300005200 | Ga0072940_1444683 | Ga0072940_14446831 | 77 |
| 4 | 3300010049 | Ga0123356_13197850 | Ga0123356_131978501 | 77 |
| 5 | 3300038395 | Ga0415639_017048 | Ga0415639_017048_2130_2363 | 77 |
| 6 | 3300038395 | Ga0415639_038638 | Ga0415639_038638_1648_1881 | 77 |
| 7 | 3300042598 | Ga0466701_049828 | Ga0466701_049828_516_749 | 77 |
| 8 | 3300010167 | Ga0123353_10149101 | Ga0123353_101491017 | 78 |
| 9 | 3300010167 | Ga0123353_10870187 | Ga0123353_108701872 | 78 |
| 10 | 3300010167 | Ga0123353_11185470 | Ga0123353_111854702 | 78 |
| 11 | 3300010167 | Ga0123353_12702207 | Ga0123353_127022071 | 78 |
| 12 | 3300024493 | Ga0264413_141473 | Ga0264413_1414732 | 78 |
| 13 | 3300038395 | Ga0415639_071598 | Ga0415639_071598_1191_1427 | 78 |
| 14 | 3300038395 | Ga0415639_087454 | Ga0415639_087454_724_960 | 78 |
| 15 | 3300042594 | Ga0466694_050516 | Ga0466694_050516_1053_1289 | 78 |
| 16 | 3300042597 | Ga0466699_009592 | Ga0466699_009592_2348_2584 | 78 |
| 17 | 3300042597 | Ga0466699_118926 | Ga0466699_118926_4835_5071 | 78 |
| 18 | 3300042607 | Ga0466720_013118 | Ga0466720_013118_1119_1355 | 78 |
| 19 | 3300042607 | Ga0466720_080479 | Ga0466720_080479_1637_1873 | 78 |
| 20 | 3300042614 | Ga0466712_012308 | Ga0466712_012308_1130_1366 | 78 |
| 21 | 3300042614 | Ga0466712_014291 | Ga0466712_014291_758_994 | 78 |
| 22 | 3300042617 | Ga0466718_060924 | Ga0466718_060924_105_341 | 78 |
| 23 | 3300042622 | Ga0466731_173177 | Ga0466731_173177_252_488 | 78 |
| 24 | iso_pr_bacteria | 2781125692 | 2781431793 | 78 |
| 25 | iso_pr_bacteria | 2820021908 | 2820022134 | 78 |
| 26 | 2030936001 | Nasutiter_FTJKGMZ01CF6IS | Nasutiterm_453920 | 79 |
| 27 | 3300002449 | JGI24698J34947_10063319 | JGI24698J34947_100633193 | 79 |
| 28 | 3300002449 | JGI24698J34947_10084796 | JGI24698J34947_100847963 | 79 |
| 29 | 3300002449 | JGI24698J34947_10140428 | JGI24698J34947_101404282 | 79 |
| 30 | 3300002449 | JGI24698J34947_10150378 | JGI24698J34947_101503781 | 79 |
| 31 | 3300002449 | JGI24698J34947_10292408 | JGI24698J34947_102924082 | 79 |
| 32 | 3300005200 | Ga0072940_1011785 | Ga0072940_10117856 | 79 |
| 33 | 3300005201 | Ga0072941_1015462 | Ga0072941_10154629 | 79 |
| 34 | 3300005201 | Ga0072941_1025711 | Ga0072941_10257111 | 79 |
| 35 | 3300005201 | Ga0072941_1066587 | Ga0072941_10665873 | 79 |
| 36 | 3300010049 | Ga0123356_13287272 | Ga0123356_132872722 | 79 |
| 37 | 3300010049 | Ga0123356_13930693 | Ga0123356_139306931 | 79 |
| 38 | 3300010167 | Ga0123353_10621651 | Ga0123353_106216511 | 79 |
| 39 | 3300010167 | Ga0123353_11133111 | Ga0123353_111331112 | 79 |
| 40 | 3300010167 | Ga0123353_12344989 | Ga0123353_123449892 | 79 |
| 41 | 3300010882 | Ga0123354_10007821 | Ga0123354_1000782110 | 79 |
| 42 | 3300010882 | Ga0123354_10808504 | Ga0123354_108085041 | 79 |
| 43 | 3300042592 | Ga0466693_381940 | Ga0466693_381940_806_1045 | 79 |
| 44 | 3300042601 | Ga0466707_394843 | Ga0466707_394843_1686_1925 | 79 |
| 45 | 3300042603 | Ga0466714_001763 | Ga0466714_001763_227_466 | 79 |
| 46 | 3300042603 | Ga0466714_149889 | Ga0466714_149889_1122_1361 | 79 |
| 47 | 3300042606 | Ga0466719_319074 | Ga0466719_319074_79_318 | 79 |
| 48 | 3300042612 | Ga0466705_348892 | Ga0466705_348892_4872_5111 | 79 |
| 49 | 3300042622 | Ga0466731_204413 | Ga0466731_204413_194_433 | 79 |
| 50 | 3300042643 | Ga0466704_114097 | Ga0466704_114097_924_1163 | 79 |
| 51 | 3300042643 | Ga0466704_187496 | Ga0466704_187496_70_309 | 79 |
| 52 | 3300042659 | Ga0466733_208429 | Ga0466733_208429_18_257 | 79 |
| 53 | iso_pr_bacteria | 2820132692 | 2820133888 | 79 |
| 54 | 3300002834 | JGI24696J40584_12694684 | JGI24696J40584_126946842 | 80 |
| 55 | 3300009826 | Ga0123355_10156652 | Ga0123355_101566523 | 80 |
| 56 | 3300010049 | Ga0123356_10056116 | Ga0123356_100561162 | 80 |
| 57 | 3300010167 | Ga0123353_10000180 | Ga0123353_100001808 | 80 |
| 58 | 3300010167 | Ga0123353_10122636 | Ga0123353_101226363 | 80 |
| 59 | 3300010167 | Ga0123353_10600108 | Ga0123353_106001081 | 80 |
| 60 | 3300010167 | Ga0123353_11014032 | Ga0123353_110140323 | 80 |
| 61 | 3300010167 | Ga0123353_11048056 | Ga0123353_110480562 | 80 |
| 62 | 3300010167 | Ga0123353_11324786 | Ga0123353_113247861 | 80 |
| 63 | 3300010167 | Ga0123353_11412314 | Ga0123353_114123142 | 80 |
| 64 | 3300010167 | Ga0123353_11519516 | Ga0123353_115195162 | 80 |
| 65 | 3300010167 | Ga0123353_11620204 | Ga0123353_116202042 | 80 |
| 66 | 3300010167 | Ga0123353_11902481 | Ga0123353_119024812 | 80 |
| 67 | 3300010167 | Ga0123353_12215717 | Ga0123353_122157172 | 80 |
| 68 | 3300010167 | Ga0123353_12752427 | Ga0123353_127524272 | 80 |
| 69 | 3300010167 | Ga0123353_13163370 | Ga0123353_131633702 | 80 |
| 70 | 3300010167 | Ga0123353_13303468 | Ga0123353_133034682 | 80 |
| 71 | 3300042601 | Ga0466707_345066 | Ga0466707_345066_745_987 | 80 |
| 72 | 3300042612 | Ga0466705_070035 | Ga0466705_070035_2081_2323 | 80 |
| 73 | 3300042617 | Ga0466718_013494 | Ga0466718_013494_6683_6925 | 80 |
| 74 | 3300042619 | Ga0466726_326927 | Ga0466726_326927_813_1055 | 80 |
| 75 | 3300042619 | Ga0466726_359850 | Ga0466726_359850_7464_7706 | 80 |
| 76 | 3300042623 | Ga0466734_167665 | Ga0466734_167665_808_1050 | 80 |
| 77 | 3300042635 | Ga0466702_307222 | Ga0466702_307222_3191_3433 | 80 |
| 78 | 3300042635 | Ga0466702_456271 | Ga0466702_456271_454_696 | 80 |
| 79 | 3300042648 | Ga0466709_405001 | Ga0466709_405001_557_799 | 80 |
| 80 | 3300042655 | Ga0466727_051577 | Ga0466727_051577_1305_1547 | 80 |
| 81 | 3300042655 | Ga0466727_351029 | Ga0466727_351029_186_428 | 80 |
| 82 | 3300002450 | JGI24695J34938_10074661 | JGI24695J34938_100746613 | 81 |
| 83 | 3300005071 | Ga0068302_10129650 | Ga0068302_101296502 | 81 |
| 84 | 3300009826 | Ga0123355_10927938 | Ga0123355_109279383 | 81 |
| 85 | 3300010049 | Ga0123356_10054531 | Ga0123356_100545314 | 81 |
| 86 | 3300010049 | Ga0123356_10180820 | Ga0123356_101808204 | 81 |
| 87 | 3300010049 | Ga0123356_10661699 | Ga0123356_106616993 | 81 |
| 88 | 3300010167 | Ga0123353_10003522 | Ga0123353_1000352215 | 81 |
| 89 | 3300042601 | Ga0466707_308804 | Ga0466707_308804_1416_1661 | 81 |
| 90 | iso_pr_bacteria | 2556921669 | 2558278959 | 81 |
| 91 | 3300010167 | Ga0123353_10103056 | Ga0123353_101030562 | 82 |
| 92 | 3300042550 | Ga0466656_214906 | Ga0466656_214906_662_913 | 83 |
| 93 | 3300009784 | Ga0123357_10398946 | Ga0123357_103989462 | 84 |
| 94 | 3300009826 | Ga0123355_10309206 | Ga0123355_103092062 | 84 |
| 95 | 3300010167 | Ga0123353_10373358 | Ga0123353_103733582 | 84 |
| 96 | 3300010167 | Ga0123353_13018236 | Ga0123353_130182362 | 84 |
| 97 | 3300042614 | Ga0466712_037523 | Ga0466712_037523_719_973 | 84 |
| 98 | 3300042614 | Ga0466712_059405 | Ga0466712_059405_4335_4589 | 84 |
| 99 | 3300042614 | Ga0466712_257006 | Ga0466712_257006_1913_2167 | 84 |
| 100 | 3300002449 | JGI24698J34947_10104834 | JGI24698J34947_101048342 | 85 |
| 101 | 3300002504 | JGI24705J35276_11543058 | JGI24705J35276_115430582 | 85 |
| 102 | 3300002504 | JGI24705J35276_11609616 | JGI24705J35276_116096162 | 85 |
| 103 | 3300042611 | Ga0466697_108874 | Ga0466697_108874_1075_1332 | 85 |
| 104 | 3300042597 | Ga0466699_129361 | Ga0466699_129361_780_1043 | 87 |
| 105 | 3300042601 | Ga0466707_402935 | Ga0466707_402935_65_328 | 87 |
| 106 | 3300042622 | Ga0466731_117485 | Ga0466731_117485_546_812 | 88 |
| 107 | 3300038395 | Ga0415639_250748 | Ga0415639_250748_815_1084 | 89 |
| 108 | 3300042590 | Ga0466690_136841 | Ga0466690_136841_346_618 | 90 |
| 109 | 3300042618 | Ga0466723_019360 | Ga0466723_019360_1841_2113 | 90 |
| 110 | 3300042643 | Ga0466704_091271 | Ga0466704_091271_1986_2258 | 90 |
| 111 | 3300042643 | Ga0466704_209225 | Ga0466704_209225_2327_2599 | 90 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02604 | PhdYeFM_antitox | Antitoxin Phd_YefM, type II toxin-antitoxin system | 1 | 45 | 0.92 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.45 | 0.76 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.