Protein Family IF09407
Metagenome
Isolate
156
Members
76
Samples
130
Scaffolds
716.33
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_172711|Ga0466704_172711_34675_37257
- Length
- 841 aa
- Sequence
- MTDILTEADPAVTTALAGRDGVQPKRRRGRDGAHLGRDSAPSDGPGPVAQVVKRDGTVVAFDLARIASAMARAGQASGEFDPAEAELLARFAVRKLDRPRPAVEQIQDSVEATLINAGYHATARAYIVYRENHSRLRADAKVVVDVESSINEYLDRSDWRVNANANQGYSLGGLILNTSGKIIANYWLSHVYSPQIGQAHRQGDLHIHDLDMLSGYCAGWSLRTLLTEGLNGVPGKIDAAPPKHFSSAIGQIVNFLGTLQNEWAGAQAFSSFDTYMAPFVRIDQMTYEQVLQGVQELVYNLNVPSRWGTQTPFTNLTFDWTCPEDLRDQRPVIGGVEQDFAYGDLVEEMALINRAYIEVMTTGDATGRVFTFPIPTYNITADFPWESPNAERLFAMTAKYGLPYFQNFINSELKPNQIRSMCCRLQLDLRELLKRGNGLFGSAEQTGSVGVVTINCARLGYRHAGDEAGLTAALDRLLELARDSLEVKRKVIQRLIDQGLFPYTKRYLGTLRNHFSTIGVNGLHELARNFFAASDPAARDGGLTTQAGHALVVRLLDRVRQLMVEFQEATGHLYNLEATPAEGTTYRFAKEDRRRFPDIIQAGTADNPYYTNSSQLPVGFTDDPFEALSRQDELQRKYTGGTVLHLYMSERLSDATACRELVRRSLSRFSLPYITVTPTFSICPAHGYLAGEQPTCPRCAAEDPTAEPTVCEVWTRVMGYHRPVSSFNIGKRGEHAERRHFRQSRSGLDQPWEPAAVADPSGSAVVALVEGDSAASPEKMPVTSSATPIRSADGTPATTLPAVVPGGMLPAPAAASPVVVLAERPEAAQSAAAEADRAVAA
Sample Types
Isolate
16.7%
Metagenome
83.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.4%
Unclassified
29.6%
Kalotermitidae
18.3%
Elmidae
5.6%
Rhinotermitidae
2.8%
Termopsidae
2.8%
Crambidae
1.4%
Hodotermitidae
1.4%
Hydrophilidae
1.4%
Gryllidae
1.4%
Drosophilidae
1.4%
Apidae
1.4%
Taxonomy
Archaea
0
Bacteria
142
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820880921 | Unclassified Actinobacteria Lab288P1bin60 | Isolate | Unclassified |
| 2 | 2820934415 | Unclassified Actinobacteria Emb289P1bin68 | Isolate | Unclassified |
| 3 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 4 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 5 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 6 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 7 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 8 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 9 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 10 | 2820911766 | Unclassified Actinobacteria Emb289P3bin96 | Isolate | Unclassified |
| 11 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 12 | 2773857778 | Unclassified Fibrobacteres Co191P1bin56 | Isolate | Unclassified |
| 13 | 2820566695 | Unclassified Firmicutes Emb289P3bin50 | Isolate | Unclassified |
| 14 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 15 | 2778260936 | Unclassified Fibrobacteres Co191P3bin13 | Isolate | Unclassified |
| 16 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 17 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 18 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 19 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 20 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 21 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 26 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 27 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 28 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 29 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 30 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 31 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 32 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 33 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 34 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 35 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 36 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 37 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 38 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 39 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 40 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 41 | 2820688768 | Unclassified Firmicutes Co191P1bin74 | Isolate | Unclassified |
| 42 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 43 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 44 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 45 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 46 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 47 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 48 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 49 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 50 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 51 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 52 | 2820563109 | Unclassified Firmicutes Emb289P3bin58 | Isolate | Unclassified |
| 53 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 54 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 55 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 56 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 57 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 58 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 59 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 60 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 61 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 62 | 2778260935 | Unclassified Fibrobacteres Co191P1bin79 | Isolate | Unclassified |
| 63 | 2778260938 | Unclassified Fibrobacteres Co191P3bin71 | Isolate | Unclassified |
| 64 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 65 | 2820157249 | Unclassified Proteobacteria Cu122P4bin11 | Isolate | Unclassified |
| 66 | 2820161938 | Unclassified Proteobacteria Cu122P3bin14 | Isolate | Unclassified |
| 67 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 68 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 69 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 70 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 71 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 72 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 73 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 74 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 75 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 76 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10004544 | 3300010049 | Bacteria | 14310 |
| 2 | Ga0123356_10005029 | 3300010049 | Bacteria | 13551 |
| 3 | Ga0123356_10014742 | 3300010049 | Bacteria | 7509 |
| 4 | Ga0123353_10018386 | 3300010167 | Bacteria | 10335 |
| 5 | Ga0466706_122046 | 3300042599 | Bacteria | 228896 |
| 6 | Ga0466714_100267 | 3300042603 | Bacteria | 2983 |
| 7 | Ga0466716_037105 | 3300042605 | Unclassified | 10352 |
| 8 | Ga0466719_124462 | 3300042606 | Bacteria | 41665 |
| 9 | Ga0264413_140529 | 3300024493 | Bacteria | 21082 |
| 10 | Ga0466691_018945 | 3300042593 | Bacteria | 5782 |
| 11 | Ga0466691_033095 | 3300042593 | Bacteria | 6021 |
| 12 | Ga0466705_059472 | 3300042612 | Bacteria | 2880 |
| 13 | Ga0466705_191328 | 3300042612 | Bacteria | 19348 |
| 14 | Ga0466703_097355 | 3300042636 | Bacteria | 13918 |
| 15 | Ga0466704_172711 | 3300042643 | Bacteria | 164859 |
| 16 | Ga0466704_314163 | 3300042643 | Bacteria | 16847 |
| 17 | Ga0466709_042370 | 3300042648 | Bacteria | 9258 |
| 18 | Ga0466727_074602 | 3300042655 | Bacteria | 28685 |
| 19 | Ga0466712_217418 | 3300042614 | Bacteria | 3288 |
| 20 | Ga0466711_203212 | 3300042615 | Bacteria | 9064 |
| 21 | Ga0466711_263485 | 3300042615 | Bacteria | 11682 |
| 22 | Ga0466715_492607 | 3300042616 | Bacteria | 3558 |
| 23 | Ga0466723_012735 | 3300042618 | Bacteria | 10327 |
| 24 | Ga0466726_410068 | 3300042619 | Bacteria | 25293 |
| 25 | Ga0466732_246256 | 3300042656 | Bacteria | 5935 |
| 26 | Ga0123356_10000888 | 3300010049 | Bacteria | 33102 |
| 27 | Ga0123356_10032678 | 3300010049 | Bacteria | 4867 |
| 28 | Ga0466719_083308 | 3300042606 | Bacteria | 41647 |
| 29 | Ga0466720_011640 | 3300042607 | Unclassified | 7991 |
| 30 | Ga0160432_100240 | 3300012818 | Unclassified | 46873 |
| 31 | Ga0160452_100319 | 3300012834 | Bacteria | 42649 |
| 32 | AustNasuHG_c1000094 | 3300000089 | Bacteria | 25892 |
| 33 | JGI24698J34947_10051048 | 3300002449 | Unclassified | 2082 |
| 34 | Ga0072941_1004238 | 3300005201 | Bacteria | 114598 |
| 35 | Ga0466703_406130 | 3300042636 | Bacteria | 10979 |
| 36 | Ga0466704_166356 | 3300042643 | Bacteria | 83216 |
| 37 | Ga0466732_407384 | 3300042656 | Bacteria | 7429 |
| 38 | Ga0123356_10008057 | 3300010049 | Bacteria | 10483 |
| 39 | Ga0123356_10011177 | 3300010049 | Bacteria | 8767 |
| 40 | Ga0123356_10017485 | 3300010049 | Bacteria | 6821 |
| 41 | Ga0466713_062246 | 3300042602 | Bacteria | 29334 |
| 42 | Ga0466720_125427 | 3300042607 | Bacteria | 2973 |
| 43 | Ga0072941_1062228 | 3300005201 | Unclassified | 4706 |
| 44 | Ga0105005_1275323 | 3300007505 | Bacteria | 4498 |
| 45 | Ga0466703_058209 | 3300042636 | Bacteria | 6731 |
| 46 | Ga0466704_601132 | 3300042643 | Bacteria | 181308 |
| 47 | Ga0466725_058752 | 3300042654 | Bacteria | 21946 |
| 48 | Ga0466718_045883 | 3300042617 | Bacteria | 65046 |
| 49 | Ga0466723_046508 | 3300042618 | Bacteria | 18039 |
| 50 | Ga0466723_336610 | 3300042618 | Bacteria | 11198 |
| 51 | Ga0466728_201249 | 3300042620 | Bacteria | 76476 |
| 52 | Ga0466728_449689 | 3300042620 | Bacteria | 48197 |
| 53 | Ga0466733_090944 | 3300042659 | Bacteria | 27056 |
| 54 | Ga0123356_10001003 | 3300010049 | Unclassified | 31354 |
| 55 | Ga0123356_10005470 | 3300010049 | Bacteria | 12925 |
| 56 | Ga0123356_10007057 | 3300010049 | Bacteria | 11262 |
| 57 | Ga0466701_019652 | 3300042598 | Bacteria | 12065 |
| 58 | Ga0466701_032123 | 3300042598 | Bacteria | 2299 |
| 59 | Ga0466706_107376 | 3300042599 | Bacteria | 18823 |
| 60 | Ga0466700_322401 | 3300042600 | Bacteria | 81969 |
| 61 | Ga0466707_119737 | 3300042601 | Bacteria | 2564 |
| 62 | Ga0466713_060774 | 3300042602 | Bacteria | 81565 |
| 63 | Ga0466720_171619 | 3300042607 | Bacteria | 38427 |
| 64 | Ga0466721_294373 | 3300042608 | Unclassified | 2932 |
| 65 | Ga0415639_010880 | 3300038395 | Bacteria | 23416 |
| 66 | Ga0072941_1012927 | 3300005201 | Bacteria | 16034 |
| 67 | Ga0466704_059675 | 3300042643 | Bacteria | 5472 |
| 68 | Ga0466704_351412 | 3300042643 | Bacteria | 12877 |
| 69 | Ga0466708_167251 | 3300042652 | Bacteria | 5267 |
| 70 | Ga0466723_352003 | 3300042618 | Bacteria | 8090 |
| 71 | Ga0123355_10000090 | 3300009826 | Bacteria | 95669 |
| 72 | Ga0123356_10017202 | 3300010049 | Bacteria | 6881 |
| 73 | Ga0123353_10179679 | 3300010167 | Bacteria | 3351 |
| 74 | Ga0466716_335106 | 3300042605 | Bacteria | 16525 |
| 75 | Ga0466691_025003 | 3300042593 | Bacteria | 9115 |
| 76 | Ga0466691_094163 | 3300042593 | Bacteria | 13489 |
| 77 | JGI24695J34938_10000893 | 3300002450 | Bacteria | 27549 |
| 78 | Ga0072941_1058924 | 3300005201 | Bacteria | 5122 |
| 79 | Ga0466703_077981 | 3300042636 | Bacteria | 14853 |
| 80 | Ga0466703_175859 | 3300042636 | Bacteria | 4186 |
| 81 | Ga0466703_314406 | 3300042636 | Bacteria | 6293 |
| 82 | Ga0466704_226752 | 3300042643 | Bacteria | 22106 |
| 83 | Ga0466724_27534 | 3300042649 | Bacteria | 146715 |
| 84 | Ga0466708_403602 | 3300042652 | Bacteria | 8493 |
| 85 | Ga0466712_268848 | 3300042614 | Bacteria | 6971 |
| 86 | Ga0123356_10002558 | 3300010049 | Bacteria | 19429 |
| 87 | Ga0466706_251445 | 3300042599 | Bacteria | 2839 |
| 88 | Ga0466722_059403 | 3300042609 | Bacteria | 5533 |
| 89 | Ga0466657_053153 | 3300042582 | Unclassified | 18825 |
| 90 | Ga0466691_087685 | 3300042593 | Bacteria | 7261 |
| 91 | Ga0466696_258136 | 3300042596 | Bacteria | 5766 |
| 92 | JGI24698J34947_10004594 | 3300002449 | Bacteria | 7522 |
| 93 | JGI24695J34938_10000932 | 3300002450 | Bacteria | 26747 |
| 94 | Ga0466731_313060 | 3300042622 | Bacteria | 10559 |
| 95 | Ga0466703_154909 | 3300042636 | Bacteria | 28406 |
| 96 | Ga0466705_457955 | 3300042612 | Bacteria | 8754 |
| 97 | Ga0466726_047209 | 3300042619 | Bacteria | 7488 |
| 98 | Ga0123353_10002172 | 3300010167 | Bacteria | 24244 |
| 99 | Ga0160442_101260 | 3300012806 | Unclassified | 3180 |
| 100 | Ga0466716_541786 | 3300042605 | Bacteria | 10716 |
| 101 | Ga0466691_052296 | 3300042593 | Bacteria | 20210 |
| 102 | Ga0466705_288150 | 3300042612 | Bacteria | 3123 |
| 103 | Ga0466730_079807 | 3300042625 | Unclassified | 12475 |
| 104 | Ga0466703_130593 | 3300042636 | Bacteria | 20505 |
| 105 | Ga0466704_344749 | 3300042643 | Bacteria | 19051 |
| 106 | Ga0466705_498043 | 3300042612 | Bacteria | 5915 |
| 107 | Ga0466718_078965 | 3300042617 | Bacteria | 3441 |
| 108 | Ga0466723_044471 | 3300042618 | Bacteria | 37367 |
| 109 | Ga0123356_10000037 | 3300010049 | Bacteria | 142433 |
| 110 | Ga0123356_10002147 | 3300010049 | Bacteria | 21250 |
| 111 | Ga0123356_10021734 | 3300010049 | Bacteria | 6057 |
| 112 | Ga0123356_10074778 | 3300010049 | Unclassified | 3189 |
| 113 | Ga0123353_10048942 | 3300010167 | Bacteria | 6733 |
| 114 | Ga0466716_359585 | 3300042605 | Bacteria | 9263 |
| 115 | Ga0466719_150510 | 3300042606 | Bacteria | 3785 |
| 116 | Ga0466721_334270 | 3300042608 | Bacteria | 25952 |
| 117 | Ga0264413_123323 | 3300024493 | Bacteria | 11847 |
| 118 | Ga0466692_049838 | 3300042591 | Bacteria | 185020 |
| 119 | Ga0466691_003390 | 3300042593 | Bacteria | 23914 |
| 120 | Ga0466691_205990 | 3300042593 | Bacteria | 57090 |
| 121 | JGI24698J34947_10006716 | 3300002449 | Bacteria | 6320 |
| 122 | JGI24698J34947_10007871 | 3300002449 | Unclassified | 5853 |
| 123 | JGI24702J35022_10022164 | 3300002462 | Bacteria | 3441 |
| 124 | Ga0068305_10130782 | 3300005083 | Unclassified | 19493 |
| 125 | Ga0466697_119148 | 3300042611 | Unclassified | 8343 |
| 126 | Ga0466705_352338 | 3300042612 | Bacteria | 6603 |
| 127 | Ga0466703_323284 | 3300042636 | Bacteria | 21610 |
| 128 | Ga0466715_137255 | 3300042616 | Bacteria | 107557 |
| 129 | Ga0466715_622980 | 3300042616 | Bacteria | 273902 |
| 130 | Ga0466723_093155 | 3300042618 | Bacteria | 6495 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.