Protein Family IF09403
Metagenome
Isolate
190
Members
55
Samples
185
Scaffolds
97.04
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_167115|Ga0466704_167115_4483_4833
- Length
- 116 aa
- Sequence
- MKTLSVLFLPGVPKNMKWRHIMKTVRYSSGNVPKPTRKDWDRLDGVKDEDIDYSDIPEITDFSKFRPWEDRRMFKPVKVAVTCKLDADIVAWLKQGGKGYQTRLNIILRQAMNQSQ
Sample Types
Isolate
2.6%
Metagenome
97.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
51.0%
Kalotermitidae
25.5%
Unclassified
9.8%
Termopsidae
7.8%
Rhinotermitidae
5.9%
Taxonomy
Archaea
0
Bacteria
132
Eukaryota
0
Viruses
0
Unclassified
58
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 2 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 5 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 6 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 7 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 8 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 2228664002 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3a from Florida, USA | Metagenome | Termitidae |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 13 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 16 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 19 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 20 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 21 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 22 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 23 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 24 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 25 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 26 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 27 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 28 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 29 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 30 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 31 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 32 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 33 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 34 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 35 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 36 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 37 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 38 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 39 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 40 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 41 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 42 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 43 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 44 | 2228664003 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA | Metagenome | Termitidae |
| 45 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 46 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 47 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 48 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 49 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 50 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 51 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 52 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 53 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 54 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 55 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_195112 | 3300042612 | Bacteria | 1075 |
| 2 | Ga0123355_10016657 | 3300009826 | Bacteria | 11596 |
| 3 | Ga0123355_10397868 | 3300009826 | Bacteria | 1779 |
| 4 | Ga0123356_10762071 | 3300010049 | Bacteria | 1138 |
| 5 | Ga0123356_11452338 | 3300010049 | Bacteria | 845 |
| 6 | Ga0123353_10014474 | 3300010167 | Bacteria | 11377 |
| 7 | Ga0466712_119468 | 3300042614 | Bacteria | 2905 |
| 8 | Ga0466726_369058 | 3300042619 | Bacteria | 1469 |
| 9 | Ga0466726_468947 | 3300042619 | Bacteria | 2637 |
| 10 | Ga0466731_134401 | 3300042622 | Bacteria | 1393 |
| 11 | Ga0466703_049972 | 3300042636 | Bacteria | 3608 |
| 12 | Ga0466703_076365 | 3300042636 | Unclassified | 1575 |
| 13 | Ga0466704_335314 | 3300042643 | Bacteria | 1746 |
| 14 | Ga0466708_225341 | 3300042652 | Unclassified | 2215 |
| 15 | Ga0466720_109843 | 3300042607 | Bacteria | 2481 |
| 16 | Ga0466698_394669 | 3300042610 | Unclassified | 1320 |
| 17 | JGI24698J34947_10002150 | 3300002449 | Bacteria | 10563 |
| 18 | Ga0466690_346376 | 3300042590 | Bacteria | 3544 |
| 19 | Ga0466692_125859 | 3300042591 | Bacteria | 1433 |
| 20 | Ga0466696_020550 | 3300042596 | Bacteria | 4328 |
| 21 | Ga0466699_406247 | 3300042597 | Bacteria | 1421 |
| 22 | Ga0466733_161226 | 3300042659 | Bacteria | 3734 |
| 23 | Ga0466712_118596 | 3300042614 | Bacteria | 4814 |
| 24 | Ga0466711_167627 | 3300042615 | Bacteria | 1300 |
| 25 | Ga0466726_403214 | 3300042619 | Bacteria | 1481 |
| 26 | Ga0466702_312904 | 3300042635 | Bacteria | 1021 |
| 27 | Ga0466714_111522 | 3300042603 | Unclassified | 1383 |
| 28 | Ga0466722_035848 | 3300042609 | Bacteria | 2452 |
| 29 | FAAS_10269310 | 3300001880 | Unclassified | 528 |
| 30 | JGI24698J34947_10004966 | 3300002449 | Bacteria | 7287 |
| 31 | JGI24698J34947_10135864 | 3300002449 | Unclassified | 1044 |
| 32 | JGI24698J34947_10170059 | 3300002449 | Unclassified | 883 |
| 33 | JGI24698J34947_10186181 | 3300002449 | Unclassified | 825 |
| 34 | Ga0264413_112991 | 3300024493 | Bacteria | 3089 |
| 35 | Ga0265387_1003540 | 3300024582 | Bacteria | 2151 |
| 36 | Ga0466691_097333 | 3300042593 | Bacteria | 3749 |
| 37 | Ga0466691_110336 | 3300042593 | Bacteria | 1449 |
| 38 | Ga0466733_016871 | 3300042659 | Unclassified | 1156 |
| 39 | Ga0123356_10236722 | 3300010049 | Unclassified | 1894 |
| 40 | Ga0123353_12024160 | 3300010167 | Unclassified | 704 |
| 41 | Ga0123354_10368138 | 3300010882 | Unclassified | 1258 |
| 42 | Ga0466712_099260 | 3300042614 | Bacteria | 6953 |
| 43 | Ga0466715_151360 | 3300042616 | Bacteria | 1249 |
| 44 | Ga0466726_131646 | 3300042619 | Bacteria | 1594 |
| 45 | Ga0466702_356331 | 3300042635 | Bacteria | 5969 |
| 46 | Ga0466704_080197 | 3300042643 | Bacteria | 1151 |
| 47 | Ga0466704_136199 | 3300042643 | Bacteria | 1712 |
| 48 | Ga0466727_036092 | 3300042655 | Bacteria | 1474 |
| 49 | Ga0466727_175963 | 3300042655 | Unclassified | 4134 |
| 50 | Ga0466719_268300 | 3300042606 | Bacteria | 3425 |
| 51 | 2230941923 | 2228664002 | Bacteria | 16365 |
| 52 | JGI24698J34947_10006699 | 3300002449 | Bacteria | 6325 |
| 53 | JGI24698J34947_10061167 | 3300002449 | Unclassified | 1855 |
| 54 | JGI24698J34947_10315005 | 3300002449 | Unclassified | 559 |
| 55 | JGI24698J34947_10360592 | 3300002449 | Unclassified | 506 |
| 56 | JGI24695J34938_10025009 | 3300002450 | Bacteria | 2861 |
| 57 | Ga0068302_10137470 | 3300005071 | Unclassified | 1060 |
| 58 | Ga0072941_1043248 | 3300005201 | Unclassified | 4543 |
| 59 | Ga0264413_104900 | 3300024493 | Unclassified | 1109 |
| 60 | Ga0415639_060922 | 3300038395 | Bacteria | 3229 |
| 61 | Ga0466692_111161 | 3300042591 | Unclassified | 1083 |
| 62 | Ga0466692_187804 | 3300042591 | Unclassified | 1013 |
| 63 | Ga0466691_072948 | 3300042593 | Bacteria | 7310 |
| 64 | Ga0466705_243293 | 3300042612 | Bacteria | 1804 |
| 65 | Ga0466732_097822 | 3300042656 | Bacteria | 3903 |
| 66 | Ga0123356_10960600 | 3300010049 | Bacteria | 1025 |
| 67 | Ga0123353_10445629 | 3300010167 | Bacteria | 1908 |
| 68 | Ga0466712_020671 | 3300042614 | Bacteria | 9067 |
| 69 | Ga0466712_063338 | 3300042614 | Bacteria | 2699 |
| 70 | Ga0466712_238051 | 3300042614 | Unclassified | 2960 |
| 71 | Ga0466711_164882 | 3300042615 | Bacteria | 1144 |
| 72 | Ga0466726_420788 | 3300042619 | Bacteria | 2257 |
| 73 | Ga0466731_165931 | 3300042622 | Bacteria | 1018 |
| 74 | Ga0466703_364606 | 3300042636 | Unclassified | 1648 |
| 75 | Ga0466704_109215 | 3300042643 | Bacteria | 3018 |
| 76 | Ga0466727_074794 | 3300042655 | Unclassified | 1921 |
| 77 | Ga0466716_384876 | 3300042605 | Unclassified | 1991 |
| 78 | Ga0466720_071926 | 3300042607 | Bacteria | 6702 |
| 79 | Ga0466721_197449 | 3300042608 | Bacteria | 3463 |
| 80 | Ga0466722_087726 | 3300042609 | Unclassified | 1214 |
| 81 | 2230954194 | 2228664003 | Bacteria | 19769 |
| 82 | JGI24698J34947_10006622 | 3300002449 | Bacteria | 6365 |
| 83 | JGI24698J34947_10063233 | 3300002449 | Unclassified | 1814 |
| 84 | JGI24698J34947_10079336 | 3300002449 | Unclassified | 1546 |
| 85 | JGI24695J34938_10327478 | 3300002450 | Unclassified | 668 |
| 86 | JGI24695J34938_10568751 | 3300002450 | Unclassified | 525 |
| 87 | Ga0072941_1008848 | 3300005201 | Bacteria | 3000 |
| 88 | Ga0264413_129448 | 3300024493 | Bacteria | 3778 |
| 89 | Ga0415639_008550 | 3300038395 | Bacteria | 5082 |
| 90 | Ga0466694_121293 | 3300042594 | Bacteria | 3430 |
| 91 | Ga0466699_002400 | 3300042597 | Bacteria | 3978 |
| 92 | Ga0466732_001279 | 3300042656 | Bacteria | 19230 |
| 93 | Ga0466733_124549 | 3300042659 | Bacteria | 18449 |
| 94 | Ga0123357_10903449 | 3300009784 | Unclassified | 570 |
| 95 | Ga0123356_10490923 | 3300010049 | Unclassified | 1382 |
| 96 | Ga0123356_11303341 | 3300010049 | Unclassified | 889 |
| 97 | Ga0123353_11437409 | 3300010167 | Unclassified | 883 |
| 98 | Ga0466712_068356 | 3300042614 | Bacteria | 1273 |
| 99 | Ga0466715_139806 | 3300042616 | Bacteria | 1372 |
| 100 | Ga0466718_115248 | 3300042617 | Bacteria | 2260 |
| 101 | Ga0466726_335562 | 3300042619 | Unclassified | 1231 |
| 102 | Ga0466728_347877 | 3300042620 | Bacteria | 1442 |
| 103 | Ga0466735_108639 | 3300042624 | Unclassified | 1081 |
| 104 | Ga0466704_107815 | 3300042643 | Bacteria | 5204 |
| 105 | Ga0466704_328715 | 3300042643 | Bacteria | 2618 |
| 106 | Ga0466709_205120 | 3300042648 | Bacteria | 3674 |
| 107 | Ga0466727_112736 | 3300042655 | Unclassified | 2380 |
| 108 | Ga0466722_162419 | 3300042609 | Bacteria | 2453 |
| 109 | AustNasuHG_c1023929 | 3300000089 | Bacteria | 1942 |
| 110 | JGI24695J34938_10000069 | 3300002450 | Bacteria | 86031 |
| 111 | Ga0068302_10015273 | 3300005071 | Unclassified | 1198 |
| 112 | Ga0072941_1056534 | 3300005201 | Bacteria | 4103 |
| 113 | Ga0072941_1170018 | 3300005201 | Bacteria | 1332 |
| 114 | Ga0415639_131941 | 3300038395 | Unclassified | 2155 |
| 115 | Ga0466690_032855 | 3300042590 | Bacteria | 2812 |
| 116 | Ga0466694_242962 | 3300042594 | Bacteria | 1605 |
| 117 | Ga0466705_043001 | 3300042612 | Bacteria | 12081 |
| 118 | Ga0123353_10204424 | 3300010167 | Bacteria | 3104 |
| 119 | Ga0123353_10592575 | 3300010167 | Unclassified | 1587 |
| 120 | Ga0123353_10630923 | 3300010167 | Unclassified | 1522 |
| 121 | Ga0123353_10721097 | 3300010167 | Bacteria | 1395 |
| 122 | Ga0466705_495880 | 3300042612 | Bacteria | 2440 |
| 123 | Ga0466712_315105 | 3300042614 | Bacteria | 12247 |
| 124 | Ga0466726_193607 | 3300042619 | Bacteria | 1628 |
| 125 | Ga0466704_196173 | 3300042643 | Bacteria | 10953 |
| 126 | Ga0466704_200808 | 3300042643 | Bacteria | 3032 |
| 127 | Ga0466720_106576 | 3300042607 | Bacteria | 3521 |
| 128 | Ga0466722_174764 | 3300042609 | Bacteria | 1245 |
| 129 | JGI24698J34947_10067018 | 3300002449 | Unclassified | 1744 |
| 130 | JGI24698J34947_10116130 | 3300002449 | Bacteria | 1171 |
| 131 | JGI24698J34947_10117245 | 3300002449 | Unclassified | 1163 |
| 132 | JGI24698J34947_10153197 | 3300002449 | Unclassified | 954 |
| 133 | JGI24695J34938_10008545 | 3300002450 | Bacteria | 5825 |
| 134 | Ga0072941_1011847 | 3300005201 | Bacteria | 41565 |
| 135 | Ga0466690_106923 | 3300042590 | Bacteria | 2031 |
| 136 | Ga0466699_017298 | 3300042597 | Bacteria | 1842 |
| 137 | Ga0123355_10903523 | 3300009826 | Unclassified | 959 |
| 138 | Ga0123356_10769114 | 3300010049 | Bacteria | 1134 |
| 139 | Ga0466718_022534 | 3300042617 | Bacteria | 17892 |
| 140 | Ga0466718_030231 | 3300042617 | Bacteria | 8969 |
| 141 | Ga0466718_144429 | 3300042617 | Bacteria | 1879 |
| 142 | Ga0466729_157470 | 3300042621 | Bacteria | 1301 |
| 143 | Ga0466703_261070 | 3300042636 | Bacteria | 1218 |
| 144 | Ga0466704_167115 | 3300042643 | Bacteria | 5095 |
| 145 | Ga0466708_219516 | 3300042652 | Bacteria | 14698 |
| 146 | Ga0466727_253059 | 3300042655 | Bacteria | 4253 |
| 147 | Ga0466727_347590 | 3300042655 | Bacteria | 2247 |
| 148 | Ga0466716_518865 | 3300042605 | Bacteria | 4164 |
| 149 | Ga0466720_050826 | 3300042607 | Bacteria | 6240 |
| 150 | Ga0466720_085140 | 3300042607 | Unclassified | 7542 |
| 151 | AustNasuHG_c1046534 | 3300000089 | Bacteria | 978 |
| 152 | JGI24698J34947_10015974 | 3300002449 | Bacteria | 4082 |
| 153 | JGI24698J34947_10181239 | 3300002449 | Unclassified | 842 |
| 154 | JGI24695J34938_10119495 | 3300002450 | Unclassified | 1073 |
| 155 | JGI24702J35022_10284446 | 3300002462 | Bacteria | 971 |
| 156 | Ga0072941_1010154 | 3300005201 | Bacteria | 6672 |
| 157 | Ga0072941_1067726 | 3300005201 | Bacteria | 5801 |
| 158 | Ga0466692_133515 | 3300042591 | Bacteria | 2217 |
| 159 | Ga0466692_146032 | 3300042591 | Bacteria | 3620 |
| 160 | Ga0466691_046276 | 3300042593 | Unclassified | 1191 |
| 161 | Ga0466691_130556 | 3300042593 | Bacteria | 7087 |
| 162 | Ga0466699_028786 | 3300042597 | Bacteria | 1632 |
| 163 | Ga0466705_053112 | 3300042612 | Bacteria | 5977 |
| 164 | Ga0466732_207024 | 3300042656 | Unclassified | 1278 |
| 165 | Ga0466705_493390 | 3300042612 | Bacteria | 1304 |
| 166 | Ga0466718_156097 | 3300042617 | Bacteria | 1353 |
| 167 | Ga0466726_059101 | 3300042619 | Unclassified | 1058 |
| 168 | Ga0466726_141591 | 3300042619 | Bacteria | 3785 |
| 169 | Ga0466726_282589 | 3300042619 | Unclassified | 1153 |
| 170 | Ga0466726_391721 | 3300042619 | Bacteria | 1456 |
| 171 | Ga0466726_481236 | 3300042619 | Unclassified | 1617 |
| 172 | Ga0466727_022081 | 3300042655 | Unclassified | 1652 |
| 173 | Ga0466720_042690 | 3300042607 | Bacteria | 5370 |
| 174 | JGI24698J34947_10055075 | 3300002449 | Bacteria | 1983 |
| 175 | JGI24698J34947_10199413 | 3300002449 | Bacteria | 785 |
| 176 | JGI24698J34947_10322082 | 3300002449 | Unclassified | 550 |
| 177 | JGI24698J34947_10359368 | 3300002449 | Unclassified | 507 |
| 178 | JGI24702J35022_10001925 | 3300002462 | Bacteria | 12797 |
| 179 | JGI24702J35022_10036559 | 3300002462 | Unclassified | 2625 |
| 180 | JGI24702J35022_10078976 | 3300002462 | Bacteria | 1781 |
| 181 | JGI24702J35022_10232381 | 3300002462 | Bacteria | 1067 |
| 182 | JGI24702J35022_10564034 | 3300002462 | Unclassified | 702 |
| 183 | JGI24696J40584_12939193 | 3300002834 | Bacteria | 1646 |
| 184 | Ga0072940_1125098 | 3300005200 | Bacteria | 1011 |
| 185 | Ga0466694_122474 | 3300042594 | Bacteria | 1676 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF14384 | BrnA_antitoxin | BrnA antitoxin of type II toxin-antitoxin system | 55 | 112 | 0.87 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.