Protein Family IF09358
Metagenome
Isolate
167
Members
55
Samples
153
Scaffolds
328.16
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_100922|Ga0466704_100922_1870_2931
- Length
- 353 aa
- Sequence
- MPKTLRYRDGAVIYFQGENSAEKIYLLQSGKVTLSYEDIETGEDLIDLVQPGEFFGVKAALGRYPEEENAIVAHYETTIMVFSIPEFEQLVSSNMRIIMKMLKVFSRELRRVHRQTANIMEKEGYDPEDPEQGLFNVGQYYLKNKRIPQAQYIFGRYLTYYPSGKNAARAAKNLQFIRNDRGAGSVPPLAGKRSTPGVPPEGIADLPLTTAALIRKSIIGQVVRENDAGKAYHDAMDLIDQGKFQQAFVSLKAITDAGENPEYIAKSSHEIGRCLFLMNKFEECIQHFTLMITKYPKHPNLGDALFFMAQSHEKQGKKDTAEVFYRTILSKVPNGDAPINIKAKTALAALGGA
Sample Types
Isolate
8.4%
Metagenome
91.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.9%
Unclassified
25.9%
Kalotermitidae
24.1%
Termopsidae
5.6%
Rhinotermitidae
3.7%
Blaberidae
1.9%
Taxonomy
Archaea
0
Bacteria
165
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 4 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 5 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 9 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 10 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 11 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 12 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 15 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 16 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 17 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 18 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 19 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 20 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 21 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 22 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 23 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 24 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 25 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 26 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 27 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 28 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 29 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 30 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 31 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 32 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 33 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 34 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 35 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 36 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 37 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 38 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 39 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 40 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 41 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 43 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 44 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 45 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 46 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 51 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 52 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 53 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 54 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 55 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_283712 | 3300042656 | Bacteria | 4344 |
| 2 | Ga0466712_147937 | 3300042614 | Bacteria | 10406 |
| 3 | Ga0466711_028482 | 3300042615 | Bacteria | 7911 |
| 4 | Ga0466711_354629 | 3300042615 | Bacteria | 5164 |
| 5 | Ga0466718_117604 | 3300042617 | Bacteria | 11780 |
| 6 | Ga0466726_391298 | 3300042619 | Bacteria | 1527 |
| 7 | Ga0466728_094821 | 3300042620 | Bacteria | 3355 |
| 8 | Ga0466719_168888 | 3300042606 | Bacteria | 8834 |
| 9 | Ga0466719_306100 | 3300042606 | Bacteria | 1565 |
| 10 | Ga0466719_314742 | 3300042606 | Bacteria | 3126 |
| 11 | Ga0123357_10192788 | 3300009784 | Bacteria | 2342 |
| 12 | Ga0123355_10231967 | 3300009826 | Bacteria | 2634 |
| 13 | Ga0123356_10402815 | 3300010049 | Bacteria | 1506 |
| 14 | Ga0123353_10132701 | 3300010167 | Bacteria | 3995 |
| 15 | JGI24702J35022_10009140 | 3300002462 | Bacteria | 5578 |
| 16 | Ga0123357_10002380 | 3300009784 | Bacteria | 20942 |
| 17 | Ga0466704_444510 | 3300042643 | Bacteria | 2447 |
| 18 | Ga0466708_011581 | 3300042652 | Bacteria | 3339 |
| 19 | Ga0466708_084863 | 3300042652 | Bacteria | 1671 |
| 20 | Ga0466708_174644 | 3300042652 | Bacteria | 5197 |
| 21 | Ga0264413_131721 | 3300024493 | Bacteria | 1611 |
| 22 | Ga0466690_359873 | 3300042590 | Bacteria | 1538 |
| 23 | Ga0466694_052650 | 3300042594 | Bacteria | 20998 |
| 24 | Ga0466694_078720 | 3300042594 | Bacteria | 1650 |
| 25 | Ga0466694_118297 | 3300042594 | Bacteria | 12192 |
| 26 | Ga0466699_202252 | 3300042597 | Bacteria | 1838 |
| 27 | Ga0466705_264516 | 3300042612 | Bacteria | 6801 |
| 28 | Ga0466705_427202 | 3300042612 | Bacteria | 6722 |
| 29 | Ga0466712_091644 | 3300042614 | Bacteria | 12686 |
| 30 | Ga0466715_048251 | 3300042616 | Bacteria | 81213 |
| 31 | Ga0466715_345762 | 3300042616 | Bacteria | 2255 |
| 32 | Ga0466715_584769 | 3300042616 | Bacteria | 3140 |
| 33 | Ga0466718_078514 | 3300042617 | Unclassified | 2374 |
| 34 | Ga0466723_043461 | 3300042618 | Bacteria | 1810 |
| 35 | Ga0466700_086318 | 3300042600 | Bacteria | 1512 |
| 36 | Ga0466707_152939 | 3300042601 | Bacteria | 8076 |
| 37 | Ga0466719_345186 | 3300042606 | Bacteria | 13230 |
| 38 | Ga0123353_10289464 | 3300010167 | Bacteria | 2509 |
| 39 | AustNasuHG_c1004064 | 3300000089 | Bacteria | 5267 |
| 40 | JGI24695J34938_10000381 | 3300002450 | Bacteria | 43934 |
| 41 | JGI24695J34938_10010997 | 3300002450 | Bacteria | 4913 |
| 42 | JGI24702J35022_10010232 | 3300002462 | Bacteria | 5250 |
| 43 | JGI24696J40584_12948270 | 3300002834 | Bacteria | 1996 |
| 44 | Ga0466735_059432 | 3300042624 | Bacteria | 9786 |
| 45 | Ga0466704_044159 | 3300042643 | Bacteria | 31280 |
| 46 | Ga0466709_119776 | 3300042648 | Bacteria | 1850 |
| 47 | Ga0466709_131583 | 3300042648 | Bacteria | 21218 |
| 48 | Ga0466709_378036 | 3300042648 | Bacteria | 6168 |
| 49 | Ga0466708_052434 | 3300042652 | Bacteria | 8951 |
| 50 | Ga0466708_224073 | 3300042652 | Bacteria | 40955 |
| 51 | Ga0264413_127800 | 3300024493 | Bacteria | 11958 |
| 52 | Ga0466693_102408 | 3300042592 | Bacteria | 19510 |
| 53 | Ga0466691_007414 | 3300042593 | Bacteria | 3832 |
| 54 | Ga0466696_120585 | 3300042596 | Bacteria | 2458 |
| 55 | Ga0466701_015668 | 3300042598 | Bacteria | 1301 |
| 56 | Ga0466712_091535 | 3300042614 | Bacteria | 6133 |
| 57 | Ga0466711_191646 | 3300042615 | Bacteria | 17519 |
| 58 | Ga0466715_219391 | 3300042616 | Bacteria | 8882 |
| 59 | Ga0466715_345382 | 3300042616 | Bacteria | 6944 |
| 60 | Ga0466715_387781 | 3300042616 | Bacteria | 15767 |
| 61 | Ga0466715_529316 | 3300042616 | Bacteria | 13287 |
| 62 | Ga0466726_389120 | 3300042619 | Bacteria | 9231 |
| 63 | Ga0466728_366655 | 3300042620 | Bacteria | 3007 |
| 64 | Ga0466722_001008 | 3300042609 | Bacteria | 6293 |
| 65 | Ga0123353_10445712 | 3300010167 | Bacteria | 1908 |
| 66 | Ga0466735_029540 | 3300042624 | Bacteria | 3786 |
| 67 | Ga0466703_315714 | 3300042636 | Bacteria | 3763 |
| 68 | Ga0466691_005131 | 3300042593 | Bacteria | 1983 |
| 69 | Ga0466696_153744 | 3300042596 | Bacteria | 4314 |
| 70 | Ga0466715_147811 | 3300042616 | Bacteria | 8913 |
| 71 | Ga0466715_179162 | 3300042616 | Bacteria | 5219 |
| 72 | Ga0466718_129222 | 3300042617 | Bacteria | 3209 |
| 73 | Ga0466718_137347 | 3300042617 | Bacteria | 2549 |
| 74 | Ga0466723_015109 | 3300042618 | Bacteria | 58838 |
| 75 | Ga0466707_006919 | 3300042601 | Bacteria | 2056 |
| 76 | Ga0466722_035457 | 3300042609 | Bacteria | 25393 |
| 77 | Ga0123353_10414741 | 3300010167 | Bacteria | 1998 |
| 78 | Ga0123353_10499036 | 3300010167 | Bacteria | 1774 |
| 79 | Ga0074263_117105 | 3300005485 | Bacteria | 1639 |
| 80 | Ga0466735_053507 | 3300042624 | Bacteria | 3450 |
| 81 | Ga0466735_192606 | 3300042624 | Bacteria | 2853 |
| 82 | Ga0466703_037670 | 3300042636 | Bacteria | 3995 |
| 83 | Ga0466703_179809 | 3300042636 | Bacteria | 4136 |
| 84 | Ga0466704_094038 | 3300042643 | Bacteria | 3490 |
| 85 | Ga0466727_138640 | 3300042655 | Bacteria | 3895 |
| 86 | Ga0466690_191045 | 3300042590 | Bacteria | 6792 |
| 87 | Ga0466691_066651 | 3300042593 | Bacteria | 22330 |
| 88 | Ga0466691_218161 | 3300042593 | Bacteria | 5489 |
| 89 | Ga0466705_101425 | 3300042612 | Bacteria | 8631 |
| 90 | Ga0466715_592226 | 3300042616 | Bacteria | 13388 |
| 91 | Ga0466726_057201 | 3300042619 | Bacteria | 1682 |
| 92 | Ga0466728_044437 | 3300042620 | Bacteria | 10881 |
| 93 | Ga0466728_281427 | 3300042620 | Bacteria | 2453 |
| 94 | Ga0466719_067410 | 3300042606 | Bacteria | 5820 |
| 95 | Ga0466722_017662 | 3300042609 | Bacteria | 38711 |
| 96 | Ga0123357_10088015 | 3300009784 | Bacteria | 4061 |
| 97 | Ga0123353_10149673 | 3300010167 | Bacteria | 3728 |
| 98 | AustNasuHG_c1000102 | 3300000089 | Bacteria | 25361 |
| 99 | JGI24698J34947_10005688 | 3300002449 | Bacteria | 6836 |
| 100 | Ga0466708_122366 | 3300042652 | Bacteria | 13202 |
| 101 | Ga0466708_453215 | 3300042652 | Bacteria | 13393 |
| 102 | Ga0466727_249314 | 3300042655 | Bacteria | 1357 |
| 103 | Ga0466727_299723 | 3300042655 | Bacteria | 2045 |
| 104 | Ga0466695_004317 | 3300042595 | Bacteria | 5694 |
| 105 | Ga0466696_076998 | 3300042596 | Bacteria | 1484 |
| 106 | Ga0466699_002481 | 3300042597 | Bacteria | 3157 |
| 107 | Ga0466699_198192 | 3300042597 | Bacteria | 1588 |
| 108 | Ga0466715_208054 | 3300042616 | Bacteria | 2696 |
| 109 | Ga0466718_039958 | 3300042617 | Bacteria | 1316 |
| 110 | Ga0466723_155019 | 3300042618 | Bacteria | 12421 |
| 111 | Ga0466726_492162 | 3300042619 | Bacteria | 3484 |
| 112 | Ga0123355_10073128 | 3300009826 | Bacteria | 5496 |
| 113 | Ga0123356_10293673 | 3300010049 | Bacteria | 1727 |
| 114 | Ga0123353_10556859 | 3300010167 | Bacteria | 1652 |
| 115 | Ga0123354_10142806 | 3300010882 | Bacteria | 2950 |
| 116 | JGI24695J34938_10003943 | 3300002450 | Bacteria | 10020 |
| 117 | JGI24702J35022_10006628 | 3300002462 | Bacteria | 6682 |
| 118 | Ga0466703_205716 | 3300042636 | Bacteria | 3954 |
| 119 | Ga0466703_234510 | 3300042636 | Bacteria | 2104 |
| 120 | Ga0466704_023612 | 3300042643 | Unclassified | 5797 |
| 121 | Ga0466704_156408 | 3300042643 | Bacteria | 7708 |
| 122 | Ga0466692_060976 | 3300042591 | Bacteria | 3262 |
| 123 | Ga0466691_224774 | 3300042593 | Bacteria | 9308 |
| 124 | Ga0466695_142355 | 3300042595 | Bacteria | 5821 |
| 125 | Ga0466705_155280 | 3300042612 | Bacteria | 2113 |
| 126 | Ga0466732_209262 | 3300042656 | Bacteria | 2826 |
| 127 | Ga0466705_438064 | 3300042612 | Bacteria | 3256 |
| 128 | Ga0466712_010023 | 3300042614 | Bacteria | 2062 |
| 129 | Ga0466723_130141 | 3300042618 | Bacteria | 92926 |
| 130 | Ga0466723_156214 | 3300042618 | Bacteria | 14586 |
| 131 | Ga0466723_279169 | 3300042618 | Bacteria | 2246 |
| 132 | Ga0466726_236010 | 3300042619 | Bacteria | 7097 |
| 133 | Ga0466719_439013 | 3300042606 | Bacteria | 27379 |
| 134 | Ga0466722_087041 | 3300042609 | Bacteria | 6420 |
| 135 | Ga0466722_168692 | 3300042609 | Bacteria | 15443 |
| 136 | Ga0123353_10026426 | 3300010167 | Bacteria | 8867 |
| 137 | Ga0123353_10147096 | 3300010167 | Bacteria | 3766 |
| 138 | Ga0123354_10193099 | 3300010882 | Bacteria | 2271 |
| 139 | Ga0466703_071389 | 3300042636 | Bacteria | 17400 |
| 140 | Ga0466704_088229 | 3300042643 | Bacteria | 7874 |
| 141 | Ga0466705_314403 | 3300042612 | Bacteria | 4116 |
| 142 | Ga0466732_061770 | 3300042656 | Bacteria | 1598 |
| 143 | Ga0466733_142784 | 3300042659 | Bacteria | 4415 |
| 144 | Ga0466711_189749 | 3300042615 | Bacteria | 11841 |
| 145 | Ga0466723_270176 | 3300042618 | Bacteria | 12416 |
| 146 | Ga0466722_096463 | 3300042609 | Bacteria | 4388 |
| 147 | Ga0123353_10172569 | 3300010167 | Bacteria | 3431 |
| 148 | AustNasuHG_c1000655 | 3300000089 | Bacteria | 12267 |
| 149 | Ga0074263_106783 | 3300005485 | Bacteria | 2348 |
| 150 | Ga0466703_020388 | 3300042636 | Bacteria | 11755 |
| 151 | Ga0466704_100922 | 3300042643 | Bacteria | 19821 |
| 152 | Ga0466709_028364 | 3300042648 | Bacteria | 2125 |
| 153 | Ga0466727_143518 | 3300042655 | Bacteria | 5843 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00027 | cNMP_binding | Cyclic nucleotide-binding domain | 6 | 94 | 0.85 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.