Protein Family IF09336
Metagenome
Isolate
221
Members
49
Samples
212
Scaffolds
534.36
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_070672|Ga0466704_070672_4789_6666
- Length
- 580 aa
- Sequence
- VYRGAGKNTGETFGIPCRSVSKIRGIEDSGGRLYKFFSGIFPAPMEYAVLWVKFNLLYMLHTAKIIAQKLNSILDRKRKFYLIVLFFLSVLLSAVETAGVSVVMPFISAASNPAVIDSGWYKYFFDLLGFSSKNTFVISFGIAIIVFYIFRSFFNIFYNYSINKFSLGTFRHFATRLFKTYLALPYKVYVQKNPSVFSQMISNEANSLSELLLRRLSKKLGEKRYAANVKLSRTLWETFGNFKFIKLKGNEDKILQVFTDSVGRLSHASVISSTLGTIPKNVLENLGFSLLIAAVCFILWRYDSAEMVIPVISMYALALYRALPAVNHILEHFNEIAYREQSLHMIYDDMNLETDDEGSSPVSFTTSIRGEDLAFRYLKGDEVIKNISLEIRIGEKIAFVGESGSGKTTLVDILIGIYRPLQGHIYVDNVLIDHTNIRSWRTKIGYIPQSIYLFDGTVAENVAFGSDYHEEKIIQVLNKAKIWDFLNSKEGINTLVGEGGIQLSGGQKQRIGIARALYNDPEVLVLDEATSSLDDETESQIMNEIYDVSGSKTLIIIAHRLSTVERCDRRIQIENGMVAG
Sample Types
Isolate
4.1%
Metagenome
95.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.4%
Kalotermitidae
29.8%
Unclassified
19.1%
Rhinotermitidae
4.3%
Termopsidae
4.3%
Hodotermitidae
2.1%
Taxonomy
Archaea
0
Bacteria
213
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 6 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 7 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 8 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 9 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 10 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 11 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 12 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 13 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 14 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 15 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 18 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 19 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 22 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 23 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 24 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 25 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 26 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 27 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 28 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 29 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 30 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 31 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 32 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 33 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 34 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 35 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 36 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 37 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 38 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 39 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 40 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 41 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 42 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 43 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 44 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 45 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 46 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 47 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 48 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 49 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24695J34938_10007145 | 3300002450 | Bacteria | 6592 |
| 2 | JGI24695J34938_10021187 | 3300002450 | Bacteria | 3185 |
| 3 | JGI24695J34938_10047928 | 3300002450 | Unclassified | 1884 |
| 4 | Ga0466706_095306 | 3300042599 | Bacteria | 2256 |
| 5 | Ga0466719_043858 | 3300042606 | Bacteria | 23279 |
| 6 | Ga0466720_010554 | 3300042607 | Bacteria | 31855 |
| 7 | Ga0466720_221349 | 3300042607 | Bacteria | 1822 |
| 8 | Ga0466704_130875 | 3300042643 | Bacteria | 19898 |
| 9 | Ga0466709_175443 | 3300042648 | Bacteria | 7310 |
| 10 | Ga0466705_022584 | 3300042612 | Bacteria | 11422 |
| 11 | Ga0466712_006591 | 3300042614 | Bacteria | 27960 |
| 12 | Ga0466712_024790 | 3300042614 | Bacteria | 10813 |
| 13 | Ga0466712_131789 | 3300042614 | Bacteria | 31060 |
| 14 | Ga0466712_158108 | 3300042614 | Bacteria | 28019 |
| 15 | Ga0466715_349454 | 3300042616 | Bacteria | 41739 |
| 16 | Ga0466718_164899 | 3300042617 | Bacteria | 6068 |
| 17 | Ga0466723_103048 | 3300042618 | Bacteria | 13029 |
| 18 | Ga0466726_270297 | 3300042619 | Bacteria | 3185 |
| 19 | Ga0466728_003420 | 3300042620 | Bacteria | 3244 |
| 20 | Ga0466691_170012 | 3300042593 | Bacteria | 38393 |
| 21 | Ga0466694_123440 | 3300042594 | Bacteria | 50310 |
| 22 | Ga0466694_260291 | 3300042594 | Bacteria | 2533 |
| 23 | Ga0466694_273428 | 3300042594 | Bacteria | 6256 |
| 24 | Ga0466699_004244 | 3300042597 | Bacteria | 7305 |
| 25 | Ga0466699_033452 | 3300042597 | Bacteria | 4849 |
| 26 | AustNasuHG_c1001711 | 3300000089 | Bacteria | 7924 |
| 27 | JGI24698J34947_10000750 | 3300002449 | Bacteria | 15987 |
| 28 | JGI24702J35022_10001440 | 3300002462 | Bacteria | 14831 |
| 29 | Ga0072941_1037413 | 3300005201 | Bacteria | 14966 |
| 30 | Ga0123357_10002404 | 3300009784 | Bacteria | 20853 |
| 31 | Ga0466732_447845 | 3300042656 | Bacteria | 4960 |
| 32 | Ga0466720_234294 | 3300042607 | Bacteria | 6316 |
| 33 | Ga0466722_194492 | 3300042609 | Bacteria | 16499 |
| 34 | Ga0123356_10000141 | 3300010049 | Bacteria | 81679 |
| 35 | Ga0466704_070672 | 3300042643 | Bacteria | 9468 |
| 36 | Ga0466704_140178 | 3300042643 | Bacteria | 60046 |
| 37 | Ga0466704_318801 | 3300042643 | Bacteria | 4518 |
| 38 | Ga0466704_327262 | 3300042643 | Bacteria | 9813 |
| 39 | Ga0466709_335917 | 3300042648 | Bacteria | 15035 |
| 40 | Ga0466708_007812 | 3300042652 | Bacteria | 5701 |
| 41 | Ga0466705_026187 | 3300042612 | Bacteria | 2611 |
| 42 | Ga0466712_118468 | 3300042614 | Bacteria | 28270 |
| 43 | Ga0466712_280202 | 3300042614 | Bacteria | 19137 |
| 44 | Ga0466718_012825 | 3300042617 | Bacteria | 18566 |
| 45 | Ga0466718_159812 | 3300042617 | Bacteria | 6228 |
| 46 | Ga0466723_023955 | 3300042618 | Bacteria | 16255 |
| 47 | Ga0466723_037046 | 3300042618 | Bacteria | 13391 |
| 48 | Ga0466690_110363 | 3300042590 | Bacteria | 13720 |
| 49 | Ga0466690_245723 | 3300042590 | Bacteria | 3249 |
| 50 | Ga0466695_397366 | 3300042595 | Bacteria | 13529 |
| 51 | Ga0466699_265912 | 3300042597 | Bacteria | 12263 |
| 52 | JGI24698J34947_10013530 | 3300002449 | Bacteria | 4453 |
| 53 | JGI24695J34938_10000004 | 3300002450 | Bacteria | 163071 |
| 54 | JGI24695J34938_10000355 | 3300002450 | Bacteria | 45167 |
| 55 | JGI24695J34938_10001747 | 3300002450 | Bacteria | 17965 |
| 56 | Ga0072941_1015849 | 3300005201 | Bacteria | 9098 |
| 57 | Ga0466716_079617 | 3300042605 | Bacteria | 17316 |
| 58 | Ga0466716_178381 | 3300042605 | Bacteria | 7917 |
| 59 | Ga0466719_219629 | 3300042606 | Bacteria | 1960 |
| 60 | Ga0466719_370505 | 3300042606 | Bacteria | 17953 |
| 61 | Ga0466720_041333 | 3300042607 | Bacteria | 12993 |
| 62 | Ga0466703_243490 | 3300042636 | Bacteria | 3608 |
| 63 | Ga0466708_228224 | 3300042652 | Bacteria | 1956 |
| 64 | Ga0466708_361652 | 3300042652 | Bacteria | 14642 |
| 65 | Ga0466727_137706 | 3300042655 | Bacteria | 6745 |
| 66 | Ga0466705_226559 | 3300042612 | Bacteria | 16010 |
| 67 | Ga0466712_088146 | 3300042614 | Bacteria | 27823 |
| 68 | Ga0466712_136649 | 3300042614 | Bacteria | 51583 |
| 69 | Ga0466711_253861 | 3300042615 | Bacteria | 27822 |
| 70 | Ga0466711_340632 | 3300042615 | Unclassified | 1594 |
| 71 | Ga0466715_500757 | 3300042616 | Bacteria | 14213 |
| 72 | Ga0466718_063600 | 3300042617 | Bacteria | 2529 |
| 73 | Ga0466723_020410 | 3300042618 | Bacteria | 8029 |
| 74 | Ga0466726_168129 | 3300042619 | Unclassified | 10475 |
| 75 | Ga0466728_192264 | 3300042620 | Bacteria | 1882 |
| 76 | Ga0264413_108172 | 3300024493 | Bacteria | 18399 |
| 77 | Ga0466692_022510 | 3300042591 | Bacteria | 16288 |
| 78 | Ga0466696_024558 | 3300042596 | Bacteria | 2566 |
| 79 | Ga0466699_207465 | 3300042597 | Bacteria | 20344 |
| 80 | JGI24698J34947_10000368 | 3300002449 | Bacteria | 20225 |
| 81 | JGI24698J34947_10003320 | 3300002449 | Bacteria | 8728 |
| 82 | Ga0466722_220602 | 3300042609 | Bacteria | 8344 |
| 83 | Ga0123356_10000062 | 3300010049 | Bacteria | 112695 |
| 84 | Ga0123356_10000577 | 3300010049 | Bacteria | 40782 |
| 85 | Ga0123356_10095698 | 3300010049 | Bacteria | 2839 |
| 86 | Ga0123354_10124603 | 3300010882 | Bacteria | 3301 |
| 87 | Ga0466703_067337 | 3300042636 | Bacteria | 6874 |
| 88 | Ga0466704_055823 | 3300042643 | Bacteria | 9511 |
| 89 | Ga0466704_272070 | 3300042643 | Bacteria | 6146 |
| 90 | Ga0466705_193582 | 3300042612 | Bacteria | 8264 |
| 91 | Ga0466705_356815 | 3300042612 | Bacteria | 5435 |
| 92 | Ga0466711_120623 | 3300042615 | Bacteria | 13216 |
| 93 | Ga0466718_102882 | 3300042617 | Bacteria | 7976 |
| 94 | Ga0466723_017008 | 3300042618 | Bacteria | 19278 |
| 95 | Ga0466728_128545 | 3300042620 | Bacteria | 7781 |
| 96 | Ga0264413_102054 | 3300024493 | Bacteria | 17579 |
| 97 | Ga0264413_105157 | 3300024493 | Bacteria | 12734 |
| 98 | Ga0466690_027457 | 3300042590 | Bacteria | 3720 |
| 99 | Ga0466690_029730 | 3300042590 | Bacteria | 11611 |
| 100 | Ga0466692_190486 | 3300042591 | Bacteria | 17825 |
| 101 | Ga0466691_011813 | 3300042593 | Bacteria | 14800 |
| 102 | Ga0466694_086692 | 3300042594 | Bacteria | 12622 |
| 103 | Ga0466694_403400 | 3300042594 | Bacteria | 17229 |
| 104 | Ga0466699_082086 | 3300042597 | Bacteria | 10645 |
| 105 | Ga0466699_261341 | 3300042597 | Bacteria | 3427 |
| 106 | JGI24698J34947_10002414 | 3300002449 | Bacteria | 10060 |
| 107 | JGI24698J34947_10010360 | 3300002449 | Bacteria | 5111 |
| 108 | JGI24698J34947_10022201 | 3300002449 | Bacteria | 3407 |
| 109 | JGI24695J34938_10023828 | 3300002450 | Bacteria | 2946 |
| 110 | Ga0072941_1001626 | 3300005201 | Bacteria | 73081 |
| 111 | Ga0466716_041026 | 3300042605 | Bacteria | 3955 |
| 112 | Ga0466720_167253 | 3300042607 | Unclassified | 11837 |
| 113 | Ga0466722_008365 | 3300042609 | Bacteria | 9140 |
| 114 | Ga0466722_232568 | 3300042609 | Bacteria | 3180 |
| 115 | Ga0123355_10260200 | 3300009826 | Bacteria | 2427 |
| 116 | Ga0466703_046739 | 3300042636 | Bacteria | 28227 |
| 117 | Ga0466704_083234 | 3300042643 | Bacteria | 13562 |
| 118 | Ga0466704_136762 | 3300042643 | Bacteria | 15015 |
| 119 | Ga0466709_036259 | 3300042648 | Bacteria | 16966 |
| 120 | Ga0466709_083592 | 3300042648 | Bacteria | 16599 |
| 121 | Ga0466709_315748 | 3300042648 | Bacteria | 19630 |
| 122 | Ga0466705_077409 | 3300042612 | Bacteria | 44024 |
| 123 | Ga0466705_138412 | 3300042612 | Bacteria | 3910 |
| 124 | Ga0466723_240661 | 3300042618 | Bacteria | 25040 |
| 125 | Ga0466726_486218 | 3300042619 | Bacteria | 2144 |
| 126 | Ga0466728_290929 | 3300042620 | Bacteria | 48933 |
| 127 | Ga0264413_124108 | 3300024493 | Bacteria | 5718 |
| 128 | Ga0466694_088136 | 3300042594 | Bacteria | 4152 |
| 129 | Ga0466694_339539 | 3300042594 | Bacteria | 3652 |
| 130 | Ga0466699_042667 | 3300042597 | Bacteria | 3648 |
| 131 | Ga0466699_157175 | 3300042597 | Bacteria | 55178 |
| 132 | JGI24698J34947_10040387 | 3300002449 | Bacteria | 2409 |
| 133 | JGI24695J34938_10021162 | 3300002450 | Bacteria | 3186 |
| 134 | JGI24705J35276_12227620 | 3300002504 | Bacteria | 3034 |
| 135 | Ga0466707_185678 | 3300042601 | Bacteria | 4366 |
| 136 | Ga0466720_041453 | 3300042607 | Bacteria | 36391 |
| 137 | Ga0466720_082143 | 3300042607 | Bacteria | 16394 |
| 138 | Ga0466720_144493 | 3300042607 | Bacteria | 11063 |
| 139 | Ga0466720_218163 | 3300042607 | Bacteria | 21590 |
| 140 | Ga0466722_081727 | 3300042609 | Bacteria | 33452 |
| 141 | Ga0466698_106901 | 3300042610 | Unclassified | 1621 |
| 142 | Ga0466703_113663 | 3300042636 | Bacteria | 6581 |
| 143 | Ga0466704_456469 | 3300042643 | Bacteria | 11582 |
| 144 | Ga0466708_036566 | 3300042652 | Bacteria | 4251 |
| 145 | Ga0466708_210315 | 3300042652 | Bacteria | 30080 |
| 146 | Ga0466708_226294 | 3300042652 | Bacteria | 2654 |
| 147 | Ga0466705_152278 | 3300042612 | Bacteria | 9940 |
| 148 | Ga0466705_266113 | 3300042612 | Bacteria | 67009 |
| 149 | Ga0466711_287554 | 3300042615 | Bacteria | 2543 |
| 150 | Ga0466711_391747 | 3300042615 | Bacteria | 3022 |
| 151 | Ga0466711_495626 | 3300042615 | Bacteria | 6307 |
| 152 | Ga0466715_372618 | 3300042616 | Bacteria | 15643 |
| 153 | Ga0466718_132190 | 3300042617 | Bacteria | 17802 |
| 154 | Ga0466718_139708 | 3300042617 | Bacteria | 35662 |
| 155 | Ga0466690_158566 | 3300042590 | Bacteria | 14279 |
| 156 | Ga0466692_163898 | 3300042591 | Bacteria | 25340 |
| 157 | Ga0466693_354959 | 3300042592 | Bacteria | 16157 |
| 158 | Ga0466691_002443 | 3300042593 | Bacteria | 21767 |
| 159 | Ga0466691_097118 | 3300042593 | Bacteria | 6676 |
| 160 | Ga0466691_163744 | 3300042593 | Bacteria | 6544 |
| 161 | Ga0466696_264178 | 3300042596 | Bacteria | 5757 |
| 162 | JGI24695J34938_10000619 | 3300002450 | Bacteria | 33872 |
| 163 | JGI24695J34938_10003081 | 3300002450 | Bacteria | 11925 |
| 164 | JGI24695J34938_10003779 | 3300002450 | Bacteria | 10313 |
| 165 | JGI24695J34938_10011890 | 3300002450 | Bacteria | 4653 |
| 166 | Ga0072941_1012086 | 3300005201 | Bacteria | 7327 |
| 167 | Ga0072941_1019938 | 3300005201 | Bacteria | 7224 |
| 168 | Ga0466720_029258 | 3300042607 | Bacteria | 50082 |
| 169 | Ga0123356_10260217 | 3300010049 | Bacteria | 1818 |
| 170 | Ga0466704_095694 | 3300042643 | Bacteria | 3164 |
| 171 | Ga0466704_244046 | 3300042643 | Bacteria | 7252 |
| 172 | Ga0466704_247197 | 3300042643 | Bacteria | 134498 |
| 173 | Ga0466704_317387 | 3300042643 | Unclassified | 2447 |
| 174 | Ga0466708_073931 | 3300042652 | Bacteria | 3014 |
| 175 | Ga0466708_078052 | 3300042652 | Bacteria | 6931 |
| 176 | Ga0466712_038540 | 3300042614 | Bacteria | 38834 |
| 177 | Ga0466712_281001 | 3300042614 | Bacteria | 2047 |
| 178 | Ga0466718_033431 | 3300042617 | Bacteria | 4079 |
| 179 | Ga0264413_120324 | 3300024493 | Bacteria | 6502 |
| 180 | Ga0466694_011040 | 3300042594 | Bacteria | 12364 |
| 181 | Ga0466694_206784 | 3300042594 | Bacteria | 3936 |
| 182 | Ga0466696_196970 | 3300042596 | Bacteria | 17534 |
| 183 | Ga0466696_429070 | 3300042596 | Unclassified | 3145 |
| 184 | Ga0466699_191804 | 3300042597 | Bacteria | 7318 |
| 185 | Ga0466699_277512 | 3300042597 | Bacteria | 6981 |
| 186 | AustNasuHG_c1007818 | 3300000089 | Bacteria | 3793 |
| 187 | JGI24698J34947_10030422 | 3300002449 | Unclassified | 2847 |
| 188 | JGI24695J34938_10019402 | 3300002450 | Bacteria | 3370 |
| 189 | JGI24702J35022_10000136 | 3300002462 | Bacteria | 36676 |
| 190 | Ga0072940_1020901 | 3300005200 | Bacteria | 18403 |
| 191 | Ga0123357_10000143 | 3300009784 | Bacteria | 62834 |
| 192 | Ga0466713_132618 | 3300042602 | Bacteria | 2217 |
| 193 | Ga0466716_424797 | 3300042605 | Bacteria | 4880 |
| 194 | Ga0466716_500725 | 3300042605 | Bacteria | 24017 |
| 195 | Ga0466720_029809 | 3300042607 | Bacteria | 15349 |
| 196 | Ga0466722_164986 | 3300042609 | Bacteria | 11140 |
| 197 | Ga0466703_060786 | 3300042636 | Bacteria | 15061 |
| 198 | Ga0466703_320400 | 3300042636 | Bacteria | 47272 |
| 199 | Ga0466704_048303 | 3300042643 | Bacteria | 15236 |
| 200 | Ga0466709_394183 | 3300042648 | Bacteria | 2963 |
| 201 | Ga0466708_458170 | 3300042652 | Bacteria | 2489 |
| 202 | Ga0466727_165162 | 3300042655 | Bacteria | 6323 |
| 203 | Ga0466712_113634 | 3300042614 | Bacteria | 19500 |
| 204 | Ga0466712_132504 | 3300042614 | Bacteria | 15531 |
| 205 | Ga0466711_155526 | 3300042615 | Bacteria | 10888 |
| 206 | Ga0466715_102597 | 3300042616 | Bacteria | 4425 |
| 207 | Ga0466718_047088 | 3300042617 | Bacteria | 6864 |
| 208 | Ga0466726_328179 | 3300042619 | Bacteria | 13195 |
| 209 | Ga0466728_172836 | 3300042620 | Bacteria | 4381 |
| 210 | Ga0264413_118595 | 3300024493 | Bacteria | 6862 |
| 211 | Ga0466690_286844 | 3300042590 | Bacteria | 49813 |
| 212 | Ga0466691_158280 | 3300042593 | Bacteria | 7766 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.