Protein Family IF09306
Metagenome
Isolate
143
Members
53
Samples
136
Scaffolds
165.94
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_429682|Ga0466703_429682_5062_5667
- Length
- 201 aa
- Sequence
- MWALPAESGNRMARGGAIAPGGQRIQNTVCGGICMKVFREKFEVQSAGLHPTFHDVTKQVKEIVAKSGAKDGICVVYSHHTTCSVMTQECSHDKTYFGLEFLQQDLCNIMEKLVPTCRVEGQYMHPGQKHIDFAMGLGTEEGEFTSLNTDAHLRSTFFGRNETIVIMDGGLDLGDFGYIYFVDWDQVRARKRTVQVQIIGE
Sample Types
Isolate
4.9%
Metagenome
95.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
48.1%
Kalotermitidae
25.0%
Unclassified
15.4%
Termopsidae
5.8%
Rhinotermitidae
3.8%
Passalidae
1.9%
Taxonomy
Archaea
1
Bacteria
119
Eukaryota
0
Viruses
0
Unclassified
23
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820336130 | Unclassified Firmicutes Nt197P3bin70 | Isolate | Unclassified |
| 2 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 3 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 4 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 5 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 6 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 9 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 10 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 15 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 16 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 19 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 20 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 21 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 22 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 23 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 24 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 25 | 2820451402 | Unclassified Firmicutes Lab288P3bin174 | Isolate | Unclassified |
| 26 | 2820455747 | Unclassified Firmicutes Lab288P3bin160 | Isolate | Unclassified |
| 27 | 2820522177 | Unclassified Firmicutes Lab288P1bin22 | Isolate | Unclassified |
| 28 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 29 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 30 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 31 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 32 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 33 | 2820576413 | Unclassified Firmicutes Emb289P3bin136 | Isolate | Unclassified |
| 34 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 35 | 2820229114 | Unclassified Firmicutes Th196P4bin40 | Isolate | Unclassified |
| 36 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 37 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 38 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 39 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 40 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 41 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 42 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 43 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 44 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 45 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 46 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 47 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 48 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 49 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 50 | 2820414148 | Unclassified Firmicutes Lab288P3bin93 | Isolate | Unclassified |
| 51 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 52 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 53 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466693_299346 | 3300042592 | Bacteria | 2193 |
| 2 | Ga0466696_019371 | 3300042596 | Bacteria | 5662 |
| 3 | Ga0466703_429682 | 3300042636 | Bacteria | 8672 |
| 4 | Ga0466704_559294 | 3300042643 | Bacteria | 4898 |
| 5 | Ga0466708_331418 | 3300042652 | Bacteria | 5620 |
| 6 | Ga0466711_382969 | 3300042615 | Bacteria | 59006 |
| 7 | Ga0466715_045892 | 3300042616 | Bacteria | 16916 |
| 8 | Ga0466715_148580 | 3300042616 | Bacteria | 1219 |
| 9 | Ga0466715_565815 | 3300042616 | Unclassified | 2959 |
| 10 | Ga0466718_163445 | 3300042617 | Bacteria | 1526 |
| 11 | Ga0123356_10005334 | 3300010049 | Bacteria | 13114 |
| 12 | Ga0123356_11765760 | 3300010049 | Bacteria | 768 |
| 13 | Ga0123353_10221114 | 3300010167 | Bacteria | 2961 |
| 14 | JGI24702J35022_10645375 | 3300002462 | Bacteria | 656 |
| 15 | Ga0466707_210704 | 3300042601 | Bacteria | 1086 |
| 16 | Ga0466732_174304 | 3300042656 | Unclassified | 2504 |
| 17 | Ga0466694_278387 | 3300042594 | Bacteria | 1470 |
| 18 | Ga0466696_367895 | 3300042596 | Bacteria | 9111 |
| 19 | Ga0466735_000056 | 3300042624 | Bacteria | 1392 |
| 20 | Ga0466715_410578 | 3300042616 | Bacteria | 5013 |
| 21 | Ga0123356_10039918 | 3300010049 | Bacteria | 4373 |
| 22 | Ga0123356_11390653 | 3300010049 | Bacteria | 862 |
| 23 | Ga0123353_10221441 | 3300010167 | Bacteria | 2958 |
| 24 | Ga0123353_10742005 | 3300010167 | Bacteria | 1368 |
| 25 | Ga0123353_10798240 | 3300010167 | Bacteria | 1304 |
| 26 | Ga0123353_11072865 | 3300010167 | Bacteria | 1073 |
| 27 | Ga0123353_12340531 | 3300010167 | Bacteria | 641 |
| 28 | JGI24705J35276_11829543 | 3300002504 | Bacteria | 702 |
| 29 | Ga0068302_10106911 | 3300005071 | Unclassified | 1473 |
| 30 | Ga0072940_1030517 | 3300005200 | Bacteria | 2505 |
| 31 | Ga0072941_1658386 | 3300005201 | Unclassified | 1391 |
| 32 | Ga0466719_337352 | 3300042606 | Bacteria | 57418 |
| 33 | Ga0466698_332803 | 3300042610 | Bacteria | 1626 |
| 34 | Ga0466705_378156 | 3300042612 | Bacteria | 1431 |
| 35 | Ga0466727_034493 | 3300042655 | Bacteria | 1451 |
| 36 | Ga0466712_173884 | 3300042614 | Bacteria | 1816 |
| 37 | Ga0466711_125882 | 3300042615 | Bacteria | 7444 |
| 38 | Ga0466715_188900 | 3300042616 | Bacteria | 12988 |
| 39 | Ga0466715_420765 | 3300042616 | Bacteria | 1247 |
| 40 | Ga0466718_043239 | 3300042617 | Bacteria | 1139 |
| 41 | Ga0466729_019543 | 3300042621 | Bacteria | 1607 |
| 42 | Ga0123357_10105172 | 3300009784 | Bacteria | 3622 |
| 43 | Ga0123356_10108435 | 3300010049 | Bacteria | 2677 |
| 44 | Ga0123356_10408806 | 3300010049 | Bacteria | 1496 |
| 45 | Ga0123353_10531081 | 3300010167 | Bacteria | 1703 |
| 46 | Ga0123353_10730229 | 3300010167 | Bacteria | 1383 |
| 47 | Ga0123353_11377377 | 3300010167 | Bacteria | 909 |
| 48 | Ga0123353_11580984 | 3300010167 | Unclassified | 829 |
| 49 | Ga0123353_12158748 | 3300010167 | Bacteria | 675 |
| 50 | Ga0123354_10407699 | 3300010882 | Unclassified | 1143 |
| 51 | Ga0123354_10469331 | 3300010882 | Bacteria | 1004 |
| 52 | JGI24702J35022_10014499 | 3300002462 | Bacteria | 4349 |
| 53 | JGI24705J35276_12226916 | 3300002504 | Bacteria | 2920 |
| 54 | JGI24696J40584_12912322 | 3300002834 | Bacteria | 1267 |
| 55 | Ga0072941_1252147 | 3300005201 | Bacteria | 2862 |
| 56 | Ga0466716_259905 | 3300042605 | Bacteria | 1655 |
| 57 | Ga0466720_051072 | 3300042607 | Bacteria | 1722 |
| 58 | Ga0466721_195473 | 3300042608 | Unclassified | 2449 |
| 59 | Ga0466690_254545 | 3300042590 | Bacteria | 1714 |
| 60 | Ga0466696_016931 | 3300042596 | Bacteria | 23963 |
| 61 | Ga0466703_353247 | 3300042636 | Bacteria | 6772 |
| 62 | Ga0466708_278220 | 3300042652 | Bacteria | 8173 |
| 63 | Ga0466725_452494 | 3300042654 | Unclassified | 1964 |
| 64 | Ga0466727_306754 | 3300042655 | Bacteria | 2069 |
| 65 | Ga0466711_456112 | 3300042615 | Unclassified | 2817 |
| 66 | Ga0466715_299730 | 3300042616 | Bacteria | 1831 |
| 67 | Ga0123355_10641184 | 3300009826 | Bacteria | 1244 |
| 68 | Ga0123356_10371800 | 3300010049 | Bacteria | 1559 |
| 69 | Ga0123356_10957334 | 3300010049 | Archaea | 1027 |
| 70 | Ga0123353_10027875 | 3300010167 | Bacteria | 8664 |
| 71 | Ga0123353_10318800 | 3300010167 | Bacteria | 2360 |
| 72 | Ga0123353_11750692 | 3300010167 | Unclassified | 775 |
| 73 | AustNasuHG_c1056468 | 3300000089 | Unclassified | 791 |
| 74 | JGI24698J34947_10301684 | 3300002449 | Unclassified | 577 |
| 75 | JGI24702J35022_10038240 | 3300002462 | Bacteria | 2562 |
| 76 | JGI24705J35276_12081621 | 3300002504 | Bacteria | 975 |
| 77 | Ga0466705_362146 | 3300042612 | Bacteria | 4122 |
| 78 | Ga0466691_036125 | 3300042593 | Unclassified | 2347 |
| 79 | Ga0466695_162510 | 3300042595 | Bacteria | 2133 |
| 80 | Ga0466696_249906 | 3300042596 | Bacteria | 2224 |
| 81 | Ga0466708_280807 | 3300042652 | Bacteria | 1228 |
| 82 | Ga0466715_283626 | 3300042616 | Bacteria | 22353 |
| 83 | Ga0466718_109217 | 3300042617 | Unclassified | 1749 |
| 84 | Ga0123356_10029967 | 3300010049 | Bacteria | 5094 |
| 85 | Ga0123356_10243364 | 3300010049 | Bacteria | 1871 |
| 86 | Ga0123356_11325236 | 3300010049 | Bacteria | 882 |
| 87 | Ga0123353_10051678 | 3300010167 | Unclassified | 6559 |
| 88 | Ga0123353_10252335 | 3300010167 | Unclassified | 2731 |
| 89 | JGI24702J35022_10012985 | 3300002462 | Bacteria | 4619 |
| 90 | JGI24702J35022_10280540 | 3300002462 | Bacteria | 978 |
| 91 | Ga0466717_002325 | 3300042604 | Bacteria | 10627 |
| 92 | Ga0466717_218190 | 3300042604 | Bacteria | 7338 |
| 93 | Ga0466719_169520 | 3300042606 | Bacteria | 4634 |
| 94 | Ga0466705_197642 | 3300042612 | Bacteria | 8318 |
| 95 | Ga0466703_411005 | 3300042636 | Unclassified | 23915 |
| 96 | Ga0466709_278706 | 3300042648 | Bacteria | 5734 |
| 97 | Ga0466705_525846 | 3300042612 | Bacteria | 2224 |
| 98 | Ga0466718_155089 | 3300042617 | Bacteria | 1629 |
| 99 | Ga0466728_472847 | 3300042620 | Bacteria | 1339 |
| 100 | Ga0466729_151877 | 3300042621 | Bacteria | 20423 |
| 101 | Ga0123356_10059247 | 3300010049 | Bacteria | 3572 |
| 102 | Ga0123356_10185597 | 3300010049 | Bacteria | 2106 |
| 103 | Ga0123353_10028866 | 3300010167 | Bacteria | 8536 |
| 104 | Ga0466733_017489 | 3300042659 | Bacteria | 155887 |
| 105 | Ga0466704_611651 | 3300042643 | Unclassified | 3334 |
| 106 | Ga0466715_312608 | 3300042616 | Bacteria | 3278 |
| 107 | Ga0123357_10144408 | 3300009784 | Bacteria | 2912 |
| 108 | Ga0123356_11087184 | 3300010049 | Bacteria | 968 |
| 109 | Ga0123353_10445743 | 3300010167 | Unclassified | 1908 |
| 110 | Ga0123353_10473162 | 3300010167 | Bacteria | 1836 |
| 111 | Ga0123353_11346004 | 3300010167 | Bacteria | 923 |
| 112 | Ga0123354_10245218 | 3300010882 | Bacteria | 1832 |
| 113 | IMNBL1DRAFT_c0008120 | 3300000062 | Bacteria | 5400 |
| 114 | JGI24702J35022_10191918 | 3300002462 | Bacteria | 1165 |
| 115 | JGI24702J35022_10328774 | 3300002462 | Bacteria | 909 |
| 116 | JGI24702J35022_10461645 | 3300002462 | Bacteria | 775 |
| 117 | Ga0466707_403351 | 3300042601 | Bacteria | 6312 |
| 118 | Ga0466719_206746 | 3300042606 | Unclassified | 4535 |
| 119 | Ga0466722_191317 | 3300042609 | Bacteria | 2481 |
| 120 | Ga0466696_254464 | 3300042596 | Unclassified | 3798 |
| 121 | Ga0466731_090235 | 3300042622 | Bacteria | 4663 |
| 122 | Ga0466704_175224 | 3300042643 | Bacteria | 2450 |
| 123 | Ga0466709_349257 | 3300042648 | Bacteria | 1776 |
| 124 | Ga0466708_343465 | 3300042652 | Bacteria | 12870 |
| 125 | Ga0466715_587174 | 3300042616 | Bacteria | 4237 |
| 126 | Ga0466718_003807 | 3300042617 | Unclassified | 1477 |
| 127 | Ga0123357_10158413 | 3300009784 | Bacteria | 2723 |
| 128 | Ga0123356_10045882 | 3300010049 | Bacteria | 4066 |
| 129 | Ga0123356_11784707 | 3300010049 | Bacteria | 764 |
| 130 | Ga0123353_10113778 | 3300010167 | Unclassified | 4356 |
| 131 | Ga0123353_10175035 | 3300010167 | Bacteria | 3403 |
| 132 | Ga0123353_10650263 | 3300010167 | Bacteria | 1493 |
| 133 | Ga0123353_10785940 | 3300010167 | Bacteria | 1317 |
| 134 | Ga0123354_10566220 | 3300010882 | Bacteria | 849 |
| 135 | Ga0466701_053618 | 3300042598 | Bacteria | 2063 |
| 136 | Ga0466722_238678 | 3300042609 | Bacteria | 2163 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01894 | UPF0047 | Uncharacterised protein family UPF0047 | 55 | 197 | 0.88 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.