Protein Family IF09272
Metagenome
Isolate
143
Members
50
Samples
133
Scaffolds
127.62
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_340125|Ga0466703_340125_27728_28132
- Length
- 134 aa
- Sequence
- MKLLLDTYTALWWINEHEKLSSEAKAMLLNETYLLYISLVSAWEISIKVSLGKLLEFSKLLEFTGGVRVFLAQVADMPVCLLPILPRHIEIVESLPFIHRDPFDRLLVATAKADGMTILTADENIHKYDVPSVW
Sample Types
Isolate
7.0%
Metagenome
93.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
53.1%
Unclassified
24.5%
Kalotermitidae
18.4%
Termopsidae
4.1%
Taxonomy
Archaea
1
Bacteria
116
Eukaryota
0
Viruses
0
Unclassified
26
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820249082 | Unclassified Firmicutes Th196P3bin69 | Isolate | Unclassified |
| 2 | 2820420508 | Unclassified Firmicutes Lab288P3bin68 | Isolate | Unclassified |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 5 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 6 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 7 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 8 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 9 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 10 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 11 | 2820285501 | Unclassified Firmicutes Th196P3bin142 | Isolate | Unclassified |
| 12 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 13 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 14 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 19 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 20 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 21 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 22 | 2820444930 | Unclassified Firmicutes Lab288P3bin199 | Isolate | Unclassified |
| 23 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 24 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 25 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 26 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 29 | 2820211246 | Unclassified Kiritimatiellaeota Nt197P3bin96 | Isolate | Unclassified |
| 30 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 31 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 32 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 33 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 34 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 35 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 36 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 37 | 2820271343 | Unclassified Firmicutes Th196P3bin32 | Isolate | Unclassified |
| 38 | 2820590132 | Unclassified Firmicutes Emb289P1bin84 | Isolate | Unclassified |
| 39 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 40 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 41 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 42 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 43 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 44 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 45 | 2820947865 | Unclassified Acidobacteria Nt197P3bin133 | Isolate | Unclassified |
| 46 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 47 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 48 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 49 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 50 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466728_175449 | 3300042620 | Unclassified | 1167 |
| 2 | Ga0466731_321121 | 3300042622 | Unclassified | 1781 |
| 3 | Ga0123357_10512365 | 3300009784 | Bacteria | 987 |
| 4 | Ga0123355_10190049 | 3300009826 | Bacteria | 3027 |
| 5 | Ga0123356_10111364 | 3300010049 | Bacteria | 2645 |
| 6 | Ga0123356_11242621 | 3300010049 | Bacteria | 910 |
| 7 | Ga0123353_10268588 | 3300010167 | Bacteria | 2630 |
| 8 | Ga0123353_10501774 | 3300010167 | Bacteria | 1768 |
| 9 | Ga0123353_10693225 | 3300010167 | Unclassified | 1431 |
| 10 | Ga0123353_12600075 | 3300010167 | Bacteria | 599 |
| 11 | JGI24702J35022_10184847 | 3300002462 | Bacteria | 1186 |
| 12 | Ga0072941_1277376 | 3300005201 | Bacteria | 2017 |
| 13 | Ga0466691_180504 | 3300042593 | Bacteria | 3651 |
| 14 | Ga0466713_018888 | 3300042602 | Bacteria | 4474 |
| 15 | Ga0466717_052315 | 3300042604 | Bacteria | 1409 |
| 16 | Ga0466705_371081 | 3300042612 | Bacteria | 8604 |
| 17 | Ga0466733_057630 | 3300042659 | Unclassified | 1284 |
| 18 | Ga0466726_368659 | 3300042619 | Unclassified | 2511 |
| 19 | Ga0466704_584142 | 3300042643 | Bacteria | 1125 |
| 20 | Ga0123355_10020245 | 3300009826 | Bacteria | 10618 |
| 21 | Ga0123355_10093734 | 3300009826 | Bacteria | 4752 |
| 22 | Ga0123355_10640248 | 3300009826 | Bacteria | 1245 |
| 23 | Ga0123356_10264401 | 3300010049 | Bacteria | 1806 |
| 24 | Ga0123356_11251080 | 3300010049 | Bacteria | 907 |
| 25 | Ga0123356_12136087 | 3300010049 | Bacteria | 699 |
| 26 | Ga0123353_10075413 | 3300010167 | Bacteria | 5419 |
| 27 | Ga0123353_11017754 | 3300010167 | Unclassified | 1111 |
| 28 | Ga0123353_13276630 | 3300010167 | Bacteria | 517 |
| 29 | Ga0123354_10485431 | 3300010882 | Bacteria | 974 |
| 30 | JGI24698J34947_10292113 | 3300002449 | Unclassified | 591 |
| 31 | Ga0068305_10014057 | 3300005083 | Bacteria | 5702 |
| 32 | Ga0466694_166291 | 3300042594 | Unclassified | 2476 |
| 33 | Ga0466695_342945 | 3300042595 | Bacteria | 1076 |
| 34 | Ga0466699_273722 | 3300042597 | Bacteria | 1970 |
| 35 | Ga0466720_033185 | 3300042607 | Bacteria | 15215 |
| 36 | Ga0466720_154766 | 3300042607 | Bacteria | 4323 |
| 37 | Ga0466697_073399 | 3300042611 | Bacteria | 1542 |
| 38 | Ga0466731_139114 | 3300042622 | Bacteria | 1162 |
| 39 | Ga0466704_081225 | 3300042643 | Bacteria | 1912 |
| 40 | Ga0466704_092147 | 3300042643 | Bacteria | 6691 |
| 41 | Ga0466725_149009 | 3300042654 | Bacteria | 1720 |
| 42 | Ga0123355_10464250 | 3300009826 | Bacteria | 1587 |
| 43 | Ga0123355_10520050 | 3300009826 | Unclassified | 1456 |
| 44 | Ga0123356_13140376 | 3300010049 | Bacteria | 576 |
| 45 | Ga0123353_10337878 | 3300010167 | Bacteria | 2276 |
| 46 | Ga0123353_10849238 | 3300010167 | Unclassified | 1252 |
| 47 | Ga0123353_11081969 | 3300010167 | Bacteria | 1067 |
| 48 | Ga0123353_12458762 | 3300010167 | Bacteria | 621 |
| 49 | JGI24705J35276_12199120 | 3300002504 | Bacteria | 1580 |
| 50 | Ga0072940_1335108 | 3300005200 | Bacteria | 583 |
| 51 | Ga0466733_085337 | 3300042659 | Bacteria | 1162 |
| 52 | Ga0466733_127797 | 3300042659 | Bacteria | 16675 |
| 53 | Ga0466731_084238 | 3300042622 | Unclassified | 6816 |
| 54 | Ga0466709_204154 | 3300042648 | Bacteria | 9483 |
| 55 | Ga0466708_199417 | 3300042652 | Bacteria | 16608 |
| 56 | Ga0123355_10100326 | 3300009826 | Bacteria | 4560 |
| 57 | Ga0123355_10113181 | 3300009826 | Bacteria | 4233 |
| 58 | Ga0123355_10185109 | 3300009826 | Bacteria | 3081 |
| 59 | Ga0123356_10162708 | 3300010049 | Bacteria | 2232 |
| 60 | Ga0123353_10477084 | 3300010167 | Unclassified | 1826 |
| 61 | Ga0072941_1004793 | 3300005201 | Bacteria | 23063 |
| 62 | Ga0466699_310859 | 3300042597 | Bacteria | 1547 |
| 63 | Ga0466713_035649 | 3300042602 | Bacteria | 6987 |
| 64 | Ga0466698_152872 | 3300042610 | Bacteria | 1639 |
| 65 | Ga0466705_214594 | 3300042612 | Bacteria | 1709 |
| 66 | Ga0123355_10010718 | 3300009826 | Bacteria | 14081 |
| 67 | Ga0123356_10240935 | 3300010049 | Bacteria | 1880 |
| 68 | Ga0123356_10293704 | 3300010049 | Unclassified | 1727 |
| 69 | Ga0123356_10459070 | 3300010049 | Unclassified | 1423 |
| 70 | Ga0123356_11069622 | 3300010049 | Bacteria | 976 |
| 71 | Ga0123356_11096369 | 3300010049 | Unclassified | 964 |
| 72 | Ga0123356_13662535 | 3300010049 | Bacteria | 532 |
| 73 | Ga0123353_10002005 | 3300010167 | Bacteria | 25163 |
| 74 | Ga0123353_10516151 | 3300010167 | Bacteria | 1735 |
| 75 | Ga0123353_10958106 | 3300010167 | Bacteria | 1156 |
| 76 | JGI24695J34938_10109949 | 3300002450 | Bacteria | 1123 |
| 77 | Ga0068302_10141477 | 3300005071 | Bacteria | 2137 |
| 78 | Ga0415639_015572 | 3300038395 | Bacteria | 30270 |
| 79 | Ga0466691_060812 | 3300042593 | Bacteria | 1558 |
| 80 | Ga0466694_156317 | 3300042594 | Bacteria | 4248 |
| 81 | Ga0466700_490436 | 3300042600 | Bacteria | 1263 |
| 82 | Ga0466717_222748 | 3300042604 | Bacteria | 1499 |
| 83 | Ga0466720_166502 | 3300042607 | Bacteria | 1686 |
| 84 | Ga0466721_168823 | 3300042608 | Unclassified | 1069 |
| 85 | Ga0466733_012140 | 3300042659 | Unclassified | 2181 |
| 86 | Ga0466718_073692 | 3300042617 | Bacteria | 1824 |
| 87 | Ga0466725_208407 | 3300042654 | Unclassified | 1221 |
| 88 | Ga0123355_10346872 | 3300009826 | Bacteria | 1972 |
| 89 | Ga0123355_10437438 | 3300009826 | Bacteria | 1659 |
| 90 | Ga0123355_10474328 | 3300009826 | Bacteria | 1561 |
| 91 | Ga0123355_10723562 | 3300009826 | Bacteria | 1134 |
| 92 | Ga0123355_10925523 | 3300009826 | Unclassified | 941 |
| 93 | Ga0123356_10163870 | 3300010049 | Bacteria | 2224 |
| 94 | Ga0123356_11082900 | 3300010049 | Unclassified | 970 |
| 95 | Ga0123356_12371190 | 3300010049 | Bacteria | 664 |
| 96 | Ga0123353_11009319 | 3300010167 | Unclassified | 1117 |
| 97 | JGI24698J34947_10004722 | 3300002449 | Archaea | 7438 |
| 98 | JGI24698J34947_10130590 | 3300002449 | Unclassified | 1074 |
| 99 | JGI24695J34938_10067346 | 3300002450 | Bacteria | 1506 |
| 100 | Ga0466695_376687 | 3300042595 | Bacteria | 5204 |
| 101 | Ga0466721_256730 | 3300042608 | Bacteria | 2382 |
| 102 | Ga0466705_298565 | 3300042612 | Bacteria | 1014 |
| 103 | Ga0466715_037989 | 3300042616 | Bacteria | 2309 |
| 104 | Ga0123355_10004661 | 3300009826 | Bacteria | 19960 |
| 105 | Ga0123355_10045075 | 3300009826 | Bacteria | 7173 |
| 106 | Ga0123356_10512892 | 3300010049 | Unclassified | 1356 |
| 107 | Ga0123356_12009829 | 3300010049 | Bacteria | 721 |
| 108 | Ga0123353_10125436 | 3300010167 | Bacteria | 4126 |
| 109 | JGI24695J34938_10108403 | 3300002450 | Bacteria | 1132 |
| 110 | JGI24705J35276_12207392 | 3300002504 | Bacteria | 1744 |
| 111 | Ga0074263_116108 | 3300005485 | Unclassified | 905 |
| 112 | Ga0415639_026895 | 3300038395 | Bacteria | 4120 |
| 113 | Ga0466717_248428 | 3300042604 | Bacteria | 2862 |
| 114 | Ga0466720_054195 | 3300042607 | Bacteria | 4768 |
| 115 | Ga0466697_190527 | 3300042611 | Bacteria | 1042 |
| 116 | Ga0466733_128925 | 3300042659 | Bacteria | 1249 |
| 117 | Ga0466718_042328 | 3300042617 | Bacteria | 1881 |
| 118 | Ga0466731_338122 | 3300042622 | Bacteria | 1219 |
| 119 | Ga0466734_001543 | 3300042623 | Bacteria | 2501 |
| 120 | Ga0466703_340125 | 3300042636 | Bacteria | 37777 |
| 121 | Ga0466704_218494 | 3300042643 | Bacteria | 17768 |
| 122 | Ga0466708_119991 | 3300042652 | Bacteria | 1933 |
| 123 | Ga0123355_10010784 | 3300009826 | Bacteria | 14046 |
| 124 | Ga0123355_10585478 | 3300009826 | Bacteria | 1331 |
| 125 | Ga0123355_11248082 | 3300009826 | Unclassified | 752 |
| 126 | Ga0123356_10720968 | 3300010049 | Unclassified | 1167 |
| 127 | Ga0123356_13242151 | 3300010049 | Bacteria | 566 |
| 128 | Ga0123353_10196749 | 3300010167 | Bacteria | 3177 |
| 129 | JGI24702J35022_10862613 | 3300002462 | Bacteria | 564 |
| 130 | Ga0415639_017156 | 3300038395 | Bacteria | 3406 |
| 131 | Ga0466694_364390 | 3300042594 | Bacteria | 3926 |
| 132 | Ga0466695_228521 | 3300042595 | Bacteria | 2100 |
| 133 | Ga0466696_033392 | 3300042596 | Bacteria | 4983 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042595 | Ga0466695_376687 | Ga0466695_376687_4859_5173 | 104 |
| 2 | 3300042595 | Ga0466695_228521 | Ga0466695_228521_645_971 | 108 |
| 3 | 3300042593 | Ga0466691_180504 | Ga0466691_180504_1320_1649 | 109 |
| 4 | 3300038395 | Ga0415639_015572 | Ga0415639_015572_877_1260 | 114 |
| 5 | 3300042612 | Ga0466705_298565 | Ga0466705_298565_318_665 | 115 |
| 6 | iso_pr_bacteria | 2820420508 | 2820421929 | 118 |
| 7 | iso_pr_bacteria | 2820271343 | 2820272083 | 123 |
| 8 | 3300038395 | Ga0415639_017156 | Ga0415639_017156_2357_2740 | 127 |
| 9 | 3300042594 | Ga0466694_166291 | Ga0466694_166291_1176_1559 | 127 |
| 10 | 3300042596 | Ga0466696_033392 | Ga0466696_033392_4391_4774 | 127 |
| 11 | 3300042597 | Ga0466699_273722 | Ga0466699_273722_291_674 | 127 |
| 12 | 3300042600 | Ga0466700_490436 | Ga0466700_490436_55_438 | 127 |
| 13 | 3300042602 | Ga0466713_018888 | Ga0466713_018888_2001_2384 | 127 |
| 14 | 3300042602 | Ga0466713_035649 | Ga0466713_035649_218_601 | 127 |
| 15 | 3300042604 | Ga0466717_248428 | Ga0466717_248428_1140_1523 | 127 |
| 16 | 3300042607 | Ga0466720_033185 | Ga0466720_033185_11175_11558 | 127 |
| 17 | 3300042611 | Ga0466697_073399 | Ga0466697_073399_745_1128 | 127 |
| 18 | 3300042611 | Ga0466697_190527 | Ga0466697_190527_435_818 | 127 |
| 19 | 3300042612 | Ga0466705_214594 | Ga0466705_214594_717_1100 | 127 |
| 20 | 3300042617 | Ga0466718_042328 | Ga0466718_042328_324_707 | 127 |
| 21 | 3300042622 | Ga0466731_084238 | Ga0466731_084238_6393_6776 | 127 |
| 22 | 3300042623 | Ga0466734_001543 | Ga0466734_001543_1897_2280 | 127 |
| 23 | 3300042643 | Ga0466704_092147 | Ga0466704_092147_4195_4578 | 127 |
| 24 | 3300042648 | Ga0466709_204154 | Ga0466709_204154_2163_2546 | 127 |
| 25 | 3300042652 | Ga0466708_119991 | Ga0466708_119991_478_861 | 127 |
| 26 | 3300042654 | Ga0466725_149009 | Ga0466725_149009_113_496 | 127 |
| 27 | 3300042659 | Ga0466733_057630 | Ga0466733_057630_469_852 | 127 |
| 28 | iso_pr_bacteria | 2820444930 | 2820446465 | 127 |
| 29 | 3300002449 | JGI24698J34947_10130590 | JGI24698J34947_101305902 | 128 |
| 30 | 3300002450 | JGI24695J34938_10067346 | JGI24695J34938_100673463 | 128 |
| 31 | 3300005485 | Ga0074263_116108 | Ga0074263_1161081 | 128 |
| 32 | 3300009826 | Ga0123355_10020245 | Ga0123355_100202459 | 128 |
| 33 | 3300009826 | Ga0123355_10185109 | Ga0123355_101851096 | 128 |
| 34 | 3300009826 | Ga0123355_10346872 | Ga0123355_103468724 | 128 |
| 35 | 3300009826 | Ga0123355_10474328 | Ga0123355_104743283 | 128 |
| 36 | 3300009826 | Ga0123355_10520050 | Ga0123355_105200502 | 128 |
| 37 | 3300009826 | Ga0123355_10925523 | Ga0123355_109255232 | 128 |
| 38 | 3300009826 | Ga0123355_11248082 | Ga0123355_112480822 | 128 |
| 39 | 3300010049 | Ga0123356_10240935 | Ga0123356_102409351 | 128 |
| 40 | 3300010049 | Ga0123356_10512892 | Ga0123356_105128923 | 128 |
| 41 | 3300010049 | Ga0123356_10720968 | Ga0123356_107209681 | 128 |
| 42 | 3300010049 | Ga0123356_11096369 | Ga0123356_110963692 | 128 |
| 43 | 3300010167 | Ga0123353_10002005 | Ga0123353_1000200512 | 128 |
| 44 | 3300010167 | Ga0123353_10075413 | Ga0123353_100754135 | 128 |
| 45 | 3300010167 | Ga0123353_10501774 | Ga0123353_105017742 | 128 |
| 46 | 3300010167 | Ga0123353_10516151 | Ga0123353_105161513 | 128 |
| 47 | 3300010167 | Ga0123353_10693225 | Ga0123353_106932254 | 128 |
| 48 | 3300010167 | Ga0123353_11009319 | Ga0123353_110093193 | 128 |
| 49 | 3300038395 | Ga0415639_026895 | Ga0415639_026895_2949_3335 | 128 |
| 50 | 3300042593 | Ga0466691_060812 | Ga0466691_060812_84_470 | 128 |
| 51 | 3300042594 | Ga0466694_156317 | Ga0466694_156317_175_561 | 128 |
| 52 | 3300042594 | Ga0466694_364390 | Ga0466694_364390_2988_3374 | 128 |
| 53 | 3300042595 | Ga0466695_342945 | Ga0466695_342945_165_551 | 128 |
| 54 | 3300042597 | Ga0466699_310859 | Ga0466699_310859_597_983 | 128 |
| 55 | 3300042604 | Ga0466717_052315 | Ga0466717_052315_384_770 | 128 |
| 56 | 3300042604 | Ga0466717_222748 | Ga0466717_222748_1086_1472 | 128 |
| 57 | 3300042607 | Ga0466720_054195 | Ga0466720_054195_3142_3528 | 128 |
| 58 | 3300042607 | Ga0466720_154766 | Ga0466720_154766_3745_4131 | 128 |
| 59 | 3300042608 | Ga0466721_168823 | Ga0466721_168823_371_757 | 128 |
| 60 | 3300042608 | Ga0466721_256730 | Ga0466721_256730_1398_1784 | 128 |
| 61 | 3300042610 | Ga0466698_152872 | Ga0466698_152872_435_821 | 128 |
| 62 | 3300042612 | Ga0466705_371081 | Ga0466705_371081_6584_6970 | 128 |
| 63 | 3300042617 | Ga0466718_073692 | Ga0466718_073692_697_1083 | 128 |
| 64 | 3300042619 | Ga0466726_368659 | Ga0466726_368659_1539_1925 | 128 |
| 65 | 3300042620 | Ga0466728_175449 | Ga0466728_175449_579_965 | 128 |
| 66 | 3300042622 | Ga0466731_139114 | Ga0466731_139114_269_655 | 128 |
| 67 | 3300042622 | Ga0466731_321121 | Ga0466731_321121_847_1233 | 128 |
| 68 | 3300042622 | Ga0466731_338122 | Ga0466731_338122_415_801 | 128 |
| 69 | 3300042643 | Ga0466704_081225 | Ga0466704_081225_557_943 | 128 |
| 70 | 3300042643 | Ga0466704_218494 | Ga0466704_218494_2548_2934 | 128 |
| 71 | 3300042643 | Ga0466704_584142 | Ga0466704_584142_717_1103 | 128 |
| 72 | 3300042652 | Ga0466708_199417 | Ga0466708_199417_486_872 | 128 |
| 73 | 3300042654 | Ga0466725_208407 | Ga0466725_208407_231_617 | 128 |
| 74 | 3300042659 | Ga0466733_012140 | Ga0466733_012140_1525_1911 | 128 |
| 75 | 3300042659 | Ga0466733_085337 | Ga0466733_085337_322_708 | 128 |
| 76 | 3300042659 | Ga0466733_127797 | Ga0466733_127797_10721_11107 | 128 |
| 77 | iso_pr_bacteria | 2820211246 | 2820211785 | 128 |
| 78 | iso_pr_bacteria | 2820249082 | 2820250273 | 128 |
| 79 | iso_pr_bacteria | 2820267566 | 2820267871 | 128 |
| 80 | iso_pr_bacteria | 2820282995 | 2820285428 | 128 |
| 81 | iso_pr_bacteria | 2820285501 | 2820288720 | 128 |
| 82 | iso_pr_bacteria | 2820590132 | 2820590259 | 128 |
| 83 | iso_pr_bacteria | 2820947865 | 2820947885 | 128 |
| 84 | 3300002449 | JGI24698J34947_10004722 | JGI24698J34947_1000472210 | 129 |
| 85 | 3300002449 | JGI24698J34947_10292113 | JGI24698J34947_102921131 | 129 |
| 86 | 3300002450 | JGI24695J34938_10108403 | JGI24695J34938_101084032 | 129 |
| 87 | 3300002450 | JGI24695J34938_10109949 | JGI24695J34938_101099492 | 129 |
| 88 | 3300002462 | JGI24702J35022_10184847 | JGI24702J35022_101848473 | 129 |
| 89 | 3300002462 | JGI24702J35022_10862613 | JGI24702J35022_108626131 | 129 |
| 90 | 3300002504 | JGI24705J35276_12199120 | JGI24705J35276_121991203 | 129 |
| 91 | 3300005071 | Ga0068302_10141477 | Ga0068302_101414773 | 129 |
| 92 | 3300005083 | Ga0068305_10014057 | Ga0068305_100140574 | 129 |
| 93 | 3300005200 | Ga0072940_1335108 | Ga0072940_13351081 | 129 |
| 94 | 3300005201 | Ga0072941_1004793 | Ga0072941_10047935 | 129 |
| 95 | 3300005201 | Ga0072941_1277376 | Ga0072941_12773763 | 129 |
| 96 | 3300009784 | Ga0123357_10512365 | Ga0123357_105123652 | 129 |
| 97 | 3300009826 | Ga0123355_10004661 | Ga0123355_1000466119 | 129 |
| 98 | 3300009826 | Ga0123355_10010718 | Ga0123355_1001071811 | 129 |
| 99 | 3300009826 | Ga0123355_10010784 | Ga0123355_1001078415 | 129 |
| 100 | 3300009826 | Ga0123355_10045075 | Ga0123355_100450756 | 129 |
| 101 | 3300009826 | Ga0123355_10093734 | Ga0123355_100937345 | 129 |
| 102 | 3300009826 | Ga0123355_10100326 | Ga0123355_101003262 | 129 |
| 103 | 3300009826 | Ga0123355_10113181 | Ga0123355_101131811 | 129 |
| 104 | 3300009826 | Ga0123355_10190049 | Ga0123355_101900493 | 129 |
| 105 | 3300009826 | Ga0123355_10437438 | Ga0123355_104374382 | 129 |
| 106 | 3300009826 | Ga0123355_10464250 | Ga0123355_104642502 | 129 |
| 107 | 3300009826 | Ga0123355_10585478 | Ga0123355_105854782 | 129 |
| 108 | 3300009826 | Ga0123355_10640248 | Ga0123355_106402481 | 129 |
| 109 | 3300009826 | Ga0123355_10723562 | Ga0123355_107235622 | 129 |
| 110 | 3300010049 | Ga0123356_10111364 | Ga0123356_101113645 | 129 |
| 111 | 3300010049 | Ga0123356_10162708 | Ga0123356_101627082 | 129 |
| 112 | 3300010049 | Ga0123356_10264401 | Ga0123356_102644013 | 129 |
| 113 | 3300010049 | Ga0123356_10293704 | Ga0123356_102937044 | 129 |
| 114 | 3300010049 | Ga0123356_11069622 | Ga0123356_110696222 | 129 |
| 115 | 3300010049 | Ga0123356_11082900 | Ga0123356_110829002 | 129 |
| 116 | 3300010049 | Ga0123356_11242621 | Ga0123356_112426212 | 129 |
| 117 | 3300010049 | Ga0123356_11251080 | Ga0123356_112510801 | 129 |
| 118 | 3300010049 | Ga0123356_12009829 | Ga0123356_120098292 | 129 |
| 119 | 3300010049 | Ga0123356_12136087 | Ga0123356_121360871 | 129 |
| 120 | 3300010049 | Ga0123356_12371190 | Ga0123356_123711902 | 129 |
| 121 | 3300010049 | Ga0123356_13140376 | Ga0123356_131403761 | 129 |
| 122 | 3300010049 | Ga0123356_13242151 | Ga0123356_132421512 | 129 |
| 123 | 3300010049 | Ga0123356_13662535 | Ga0123356_136625351 | 129 |
| 124 | 3300010167 | Ga0123353_10125436 | Ga0123353_101254362 | 129 |
| 125 | 3300010167 | Ga0123353_10196749 | Ga0123353_101967495 | 129 |
| 126 | 3300010167 | Ga0123353_10337878 | Ga0123353_103378782 | 129 |
| 127 | 3300010167 | Ga0123353_10477084 | Ga0123353_104770842 | 129 |
| 128 | 3300010167 | Ga0123353_10849238 | Ga0123353_108492383 | 129 |
| 129 | 3300010167 | Ga0123353_10958106 | Ga0123353_109581061 | 129 |
| 130 | 3300010167 | Ga0123353_11017754 | Ga0123353_110177542 | 129 |
| 131 | 3300010167 | Ga0123353_11081969 | Ga0123353_110819692 | 129 |
| 132 | 3300010167 | Ga0123353_12458762 | Ga0123353_124587621 | 129 |
| 133 | 3300010167 | Ga0123353_12600075 | Ga0123353_126000752 | 129 |
| 134 | 3300010167 | Ga0123353_13276630 | Ga0123353_132766301 | 129 |
| 135 | 3300010882 | Ga0123354_10485431 | Ga0123354_104854313 | 129 |
| 136 | 3300042607 | Ga0466720_166502 | Ga0466720_166502_638_1027 | 129 |
| 137 | 3300042659 | Ga0466733_128925 | Ga0466733_128925_569_958 | 129 |
| 138 | 3300010049 | Ga0123356_10163870 | Ga0123356_101638704 | 130 |
| 139 | 3300010049 | Ga0123356_10459070 | Ga0123356_104590703 | 130 |
| 140 | 3300010167 | Ga0123353_10268588 | Ga0123353_102685883 | 130 |
| 141 | 3300042616 | Ga0466715_037989 | Ga0466715_037989_215_607 | 130 |
| 142 | 3300002504 | JGI24705J35276_12207392 | JGI24705J35276_122073922 | 131 |
| 143 | 3300042636 | Ga0466703_340125 | Ga0466703_340125_27728_28132 | 134 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01850 | PIN | PIN domain | 4 | 129 | 0.94 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.88 | 0.88 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.