Protein Family IF09251

Metagenome Isolate
134 Members
57 Samples
110 Scaffolds
559.06 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_308252|Ga0466703_308252_7631_9286
Length
507 aa
Sequence
VGQKSLTTTLKHAISGNKLAHAYLFCGPRGVGKTSCARIFAKTINCLNQTESFNEQRSYNYNIHELDAASNNSVDDIRALIEQVRIPPAIGKYKVFIIDEVHMLSTNAFNAFLKTLEEPPRHAIFILATTEKHKVLPTILSRCQIYDFLRISIADTVEHLEYVAQQENVKAEPEALNVIAQKADGGMRDALSIFDQAVSFTNGNVTYQAVIDNLNVLDYEYYFRLTDNMLEGNVRQALLLLNEILGRGFDGQNILSGLASHFRDLFVCKDEATLVLFEVGASIRERYRETARRCSDAFLYRAIELTNTCDLNYRASRNKRLLLELTLIQLCQLMQSPLIEPVDVPGEQRQTPPQAAPVAVVSTSIKKLMKEELSDADKQAMPTEKEQLTPIDVAAMIECWDEYAKAIEGNAYLQSTMVNCKPSLGEDYSFEVSVHNRVQHDELLNDSVNLLSYMRQQLKNTRIRMCVRISETNEKKLAYTSSEKYEHLLNINPLLHKLKEEFNLSPD

📊 Sample Types

Isolate 17.9%
Metagenome 82.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 35.1%
Kalotermitidae 22.8%
Termitidae 19.3%
Unclassified 12.3%
Termopsidae 5.3%
Rhinotermitidae 3.5%
Passalidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 134
Eukaryota 0
Viruses 0
Unclassified 0

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
2 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
3 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
4 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
5 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
6 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
7 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
8 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
9 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
10 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
11 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
12 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
13 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
14 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
15 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
16 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
17 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
18 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
19 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
20 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
21 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
22 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
23 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
24 2923982719 Parabacteroides sp. 52 Isolate Blattidae
25 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
26 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
27 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
28 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
29 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
30 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
31 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
32 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
33 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
34 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
35 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
36 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
37 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
38 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
39 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
40 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
41 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
42 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
43 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
44 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
45 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
46 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
47 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
48 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
49 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
50 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
51 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
52 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
53 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
54 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
55 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
56 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
57 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_264568 3300042612 Bacteria 2270
2 Ga0123357_10134421 3300009784 Bacteria 3064
3 Ga0123357_10149921 3300009784 Bacteria 2834
4 Ga0466707_260608 3300042601 Bacteria 6090
5 Ga0466713_048509 3300042602 Bacteria 5342
6 Ga0466716_116162 3300042605 Bacteria 19209
7 Ga0466716_230301 3300042605 Bacteria 8125
8 Ga0466719_388414 3300042606 Bacteria 11249
9 Ga0466656_358179 3300042550 Bacteria 2789
10 Ga0466703_233846 3300042636 Bacteria 8674
11 Ga0466704_041418 3300042643 Bacteria 6792
12 Ga0466704_219190 3300042643 Bacteria 28029
13 Ga0466711_074628 3300042615 Bacteria 5999
14 Ga0466723_180881 3300042618 Bacteria 3356
15 Ga0466723_194429 3300042618 Bacteria 44464
16 IMNBL1DRAFT_c0001095 3300000062 Bacteria 20769
17 Ga0123357_10004638 3300009784 Bacteria 16215
18 Ga0466707_160481 3300042601 Bacteria 32425
19 Ga0466713_082426 3300042602 Bacteria 104514
20 Ga0466735_019998 3300042624 Bacteria 4967
21 Ga0466704_155228 3300042643 Bacteria 13903
22 Ga0466704_199900 3300042643 Bacteria 2689
23 Ga0466704_421641 3300042643 Bacteria 3368
24 Ga0466727_348531 3300042655 Bacteria 2788
25 Ga0466705_473025 3300042612 Bacteria 8006
26 Ga0466723_147177 3300042618 Bacteria 19938
27 Ga0466728_302977 3300042620 Bacteria 25242
28 Ga0068305_10059018 3300005083 Bacteria 5156
29 Ga0123357_10022512 3300009784 Bacteria 8450
30 Ga0123354_10048152 3300010882 Bacteria 6486
31 Ga0466713_013897 3300042602 Bacteria 4432
32 Ga0466713_064405 3300042602 Bacteria 152501
33 Ga0466716_221991 3300042605 Bacteria 25521
34 Ga0466716_263613 3300042605 Bacteria 11222
35 Ga0466722_199658 3300042609 Bacteria 7404
36 Ga0466690_048635 3300042590 Bacteria 14569
37 Ga0466703_308252 3300042636 Bacteria 9658
38 Ga0466725_376735 3300042654 Bacteria 6114
39 Ga0466727_069574 3300042655 Bacteria 6585
40 Ga0466711_232111 3300042615 Bacteria 5084
41 Ga0466711_239934 3300042615 Bacteria 17196
42 JGI24705J35276_12235571 3300002504 Bacteria 6685
43 Ga0123357_10000272 3300009784 Bacteria 49371
44 Ga0123357_10000667 3300009784 Bacteria 34305
45 Ga0466705_223014 3300042612 Bacteria 17196
46 Ga0123357_10033022 3300009784 Bacteria 7031
47 Ga0466700_445411 3300042600 Bacteria 14608
48 Ga0466716_112700 3300042605 Bacteria 8750
49 Ga0466690_181285 3300042590 Bacteria 3366
50 Ga0466692_076352 3300042591 Bacteria 50046
51 Ga0466696_242324 3300042596 Bacteria 39108
52 Ga0466735_030140 3300042624 Bacteria 6167
53 Ga0466704_574583 3300042643 Bacteria 2716
54 Ga0466708_101648 3300042652 Bacteria 32818
55 Ga0466711_384618 3300042615 Bacteria 22548
56 Ga0466715_045974 3300042616 Bacteria 42084
57 Ga0466715_173820 3300042616 Bacteria 65966
58 Ga0466715_642914 3300042616 Bacteria 17581
59 JGI24702J35022_10013219 3300002462 Bacteria 4576
60 JGI24699J35502_11133858 3300002509 Bacteria 17217
61 Ga0466705_220129 3300042612 Bacteria 17831
62 Ga0466705_318819 3300042612 Bacteria 8925
63 Ga0466733_043800 3300042659 Bacteria 7049
64 Ga0123354_10022745 3300010882 Bacteria 9879
65 Ga0466707_012359 3300042601 Bacteria 8532
66 Ga0466703_432391 3300042636 Bacteria 4185
67 Ga0466704_237213 3300042643 Bacteria 31979
68 Ga0466711_138683 3300042615 Bacteria 30731
69 Ga0123357_10028233 3300009784 Bacteria 7591
70 Ga0123357_10031832 3300009784 Bacteria 7156
71 Ga0123354_10003491 3300010882 Bacteria 21728
72 Ga0466700_055189 3300042600 Bacteria 4124
73 Ga0466707_291043 3300042601 Bacteria 1741
74 Ga0466722_050258 3300042609 Bacteria 3067
75 Ga0466698_359841 3300042610 Bacteria 2436
76 Ga0466703_390836 3300042636 Bacteria 17272
77 Ga0466704_145824 3300042643 Bacteria 3622
78 Ga0466704_528440 3300042643 Bacteria 18129
79 Ga0466709_092384 3300042648 Bacteria 14108
80 Ga0466715_136023 3300042616 Bacteria 8171
81 JGI24699J35502_11134108 3300002509 Bacteria 31504
82 Ga0123357_10004282 3300009784 Bacteria 16691
83 Ga0123354_10001302 3300010882 Bacteria 29724
84 Ga0466707_063394 3300042601 Bacteria 26550
85 Ga0466713_078938 3300042602 Bacteria 3905
86 Ga0466713_150648 3300042602 Bacteria 6802
87 Ga0466716_175816 3300042605 Bacteria 4255
88 Ga0466722_116260 3300042609 Bacteria 15838
89 Ga0466692_117273 3300042591 Bacteria 3132
90 Ga0466696_248241 3300042596 Bacteria 3345
91 Ga0466727_166876 3300042655 Bacteria 3698
92 Ga0466711_191099 3300042615 Bacteria 3628
93 Ga0466711_214846 3300042615 Bacteria 20080
94 IMNBL1DRAFT_c0001322 3300000062 Bacteria 18635
95 Ga0123357_10004289 3300009784 Bacteria 16683
96 Ga0123357_10045487 3300009784 Bacteria 5956
97 Ga0123354_10006666 3300010882 Bacteria 17211
98 Ga0123354_10061329 3300010882 Bacteria 5551
99 Ga0466701_039482 3300042598 Bacteria 104864
100 Ga0466707_215954 3300042601 Bacteria 4292
101 Ga0466707_247680 3300042601 Bacteria 13317
102 Ga0466719_159671 3300042606 Bacteria 27854
103 Ga0466690_158972 3300042590 Bacteria 37920
104 Ga0466704_115523 3300042643 Bacteria 13352
105 Ga0466704_135115 3300042643 Bacteria 9519
106 Ga0466704_170415 3300042643 Bacteria 25587
107 Ga0466723_230208 3300042618 Bacteria 14199
108 Ga0466726_496750 3300042619 Bacteria 2287
109 JGI24705J35276_12231664 3300002504 Bacteria 4019
110 JGI24699J35502_11133841 3300002509 Bacteria 16874

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF22608 DNAX_ATPase_lid DNA polymerase III clamp loader subunit, ATPase lid domain 157 203 0.97
PF21960 RCF1-5-like_lid RCF1/5-like, AAA+ ATPase lid domain 160 191 0.93
PF12169 DNA_pol3_gamma3 DNA polymerase III subunits gamma and tau domain III 208 336 0.92
PF13177 DNA_pol3_delta2 DNA polymerase III, delta subunit 3 149 0.88
PF00004 AAA ATPase family associated with various cellular activities (AAA) 24 145 0.86
PF07728 AAA_5 AAA domain (dynein-related subfamily) 24 122 0.83
PF13401 AAA_22 AAA domain 23 127 0.64
PF13173 AAA_14 AAA domain 22 127 0.63

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF12169 GO:0003887 DNA-directed DNA polymerase activity MF
PF13401 GO:0016887 ATP hydrolysis activity MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.