Protein Family IF09228

Metagenome Isolate
169 Members
44 Samples
159 Scaffolds
344.59 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_269574|Ga0466703_269574_496_1665
Length
389 aa
Sequence
MSKTRTFFVYLSGAGIRRRFFDILGVIKQEVPMKISKKTFGVFASGKKVRLYTLKAGDLTLSVSTLGAAWTSLLAPSRNNRTDDVLLGFSTLSGYVTPKNQVGTTIGRFGNRIGGARFTLNGRTYDLYKNDGENSLHGGRRGFDKYLWKAEAYEEKDGVFVRFELQSPDGDEGYPGNLKAVVSYGLTKSQELIADYQAQVDAECPVNLTNHAYFNLAGEGRGNILAHEMQIHGKFYVDVDKNLIPTGKLLPVQGGPFDFTLRKPIGRDIEGTRGTNGSKLPDGSDGPGYDHCYVLEGDPGKLRPCADVFEPLSGRSMRVFTTQPGVQFYTGNFLDGLAGKEGSIYNRHDGFCLETQHLPDSPNRKEFPSCIFGPGRDYHERSIFSFDIL

📊 Sample Types

Isolate 5.9%
Metagenome 94.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 31.8%
Unclassified 25.0%
Termitidae 22.7%
Rhinotermitidae 9.1%
Termopsidae 6.8%
Hodotermitidae 2.3%
Blaberidae 2.3%

🌳 Taxonomy

Archaea 0
Bacteria 161
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
2 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
3 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
4 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
5 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
6 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
9 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
14 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
15 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
16 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
17 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
18 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
19 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
20 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
21 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
22 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
23 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
24 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
25 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
26 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
27 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
28 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
29 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
30 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
31 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
32 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
33 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
34 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
35 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
36 2772190975 Treponema sp. RmG30 Isolate Blaberidae
37 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
38 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
39 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
40 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
41 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
42 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
43 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
44 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_220947 3300042659 Bacteria 3135
2 Ga0466711_040500 3300042615 Bacteria 14556
3 Ga0466711_345792 3300042615 Bacteria 3112
4 Ga0466715_592485 3300042616 Bacteria 4527
5 Ga0466723_063205 3300042618 Bacteria 9369
6 Ga0466723_235889 3300042618 Bacteria 3483
7 JGI24695J34938_10000271 3300002450 Bacteria 50591
8 Ga0466703_130567 3300042636 Bacteria 4640
9 Ga0466703_208136 3300042636 Bacteria 27926
10 Ga0466703_355895 3300042636 Bacteria 56123
11 Ga0466704_556679 3300042643 Bacteria 57080
12 Ga0466708_078123 3300042652 Bacteria 26193
13 Ga0466708_447093 3300042652 Bacteria 8546
14 Ga0466727_226125 3300042655 Bacteria 1651
15 Ga0466707_031458 3300042601 Bacteria 3767
16 Ga0466716_082112 3300042605 Bacteria 2667
17 Ga0466716_085532 3300042605 Bacteria 14711
18 Ga0466716_264869 3300042605 Bacteria 3109
19 Ga0466719_097717 3300042606 Bacteria 27997
20 Ga0466733_076792 3300042659 Bacteria 3028
21 Ga0466711_342591 3300042615 Bacteria 80397
22 Ga0466711_421101 3300042615 Bacteria 12716
23 Ga0466715_120929 3300042616 Bacteria 51611
24 Ga0466715_483932 3300042616 Bacteria 2570
25 Ga0466723_070675 3300042618 Bacteria 16746
26 Ga0466723_115028 3300042618 Bacteria 5512
27 Ga0466723_359449 3300042618 Bacteria 2531
28 Ga0123353_10141440 3300010167 Bacteria 3854
29 Ga0123353_10404575 3300010167 Bacteria 2030
30 Ga0456237_0010466 3300041968 Bacteria 1369
31 Ga0466690_116380 3300042590 Unclassified 4981
32 Ga0466690_153218 3300042590 Bacteria 8249
33 Ga0466693_202625 3300042592 Bacteria 4740
34 Ga0466699_031835 3300042597 Bacteria 2391
35 JGI24695J34938_10001942 3300002450 Bacteria 16615
36 JGI24695J34938_10052041 3300002450 Bacteria 1788
37 Ga0466735_137011 3300042624 Bacteria 1776
38 Ga0466708_171804 3300042652 Bacteria 7353
39 Ga0466708_272077 3300042652 Bacteria 1251
40 Ga0466708_329664 3300042652 Bacteria 4831
41 Ga0466706_065499 3300042599 Bacteria 14473
42 Ga0466707_194269 3300042601 Bacteria 1258
43 Ga0466716_217954 3300042605 Bacteria 23090
44 Ga0466705_136902 3300042612 Bacteria 4189
45 Ga0466705_515624 3300042612 Bacteria 1694
46 Ga0466711_229331 3300042615 Bacteria 50831
47 Ga0466711_305739 3300042615 Bacteria 3967
48 Ga0466715_254683 3300042616 Bacteria 1647
49 Ga0466723_157342 3300042618 Bacteria 31675
50 Ga0466726_131690 3300042619 Bacteria 1818
51 Ga0466726_305030 3300042619 Bacteria 8435
52 Ga0466726_495723 3300042619 Bacteria 1933
53 Ga0466728_055598 3300042620 Bacteria 38254
54 Ga0466728_413970 3300042620 Bacteria 5413
55 Ga0466696_189067 3300042596 Bacteria 10414
56 JGI24695J34938_10007672 3300002450 Bacteria 6269
57 Ga0466708_025661 3300042652 Bacteria 42065
58 Ga0466708_046760 3300042652 Bacteria 10945
59 Ga0466727_042810 3300042655 Bacteria 2300
60 Ga0466716_292958 3300042605 Bacteria 4323
61 Ga0466716_375171 3300042605 Unclassified 2220
62 Ga0466719_449699 3300042606 Bacteria 3541
63 Ga0466722_116685 3300042609 Bacteria 12952
64 Ga0466705_177801 3300042612 Bacteria 3786
65 Ga0466705_302833 3300042612 Bacteria 1400
66 Ga0466733_072759 3300042659 Bacteria 51080
67 Ga0466715_376784 3300042616 Bacteria 1726
68 Ga0466715_644987 3300042616 Bacteria 5677
69 Ga0466723_251515 3300042618 Bacteria 1258
70 Ga0123353_10238700 3300010167 Bacteria 2826
71 Ga0123353_10664553 3300010167 Bacteria 1472
72 Ga0466691_005664 3300042593 Unclassified 2978
73 Ga0466691_006370 3300042593 Bacteria 22207
74 Ga0466691_090353 3300042593 Bacteria 1514
75 Ga0466694_056546 3300042594 Bacteria 22378
76 JGI24695J34938_10000036 3300002450 Bacteria 101915
77 Ga0466703_269574 3300042636 Bacteria 3391
78 Ga0466704_182376 3300042643 Bacteria 26027
79 Ga0466704_311389 3300042643 Bacteria 21292
80 Ga0466709_098990 3300042648 Bacteria 2147
81 Ga0466709_309544 3300042648 Bacteria 14117
82 Ga0466708_279225 3300042652 Bacteria 41291
83 Ga0466727_310507 3300042655 Bacteria 2698
84 Ga0466706_044835 3300042599 Bacteria 1664
85 Ga0466705_126175 3300042612 Bacteria 8018
86 Ga0466715_312876 3300042616 Bacteria 3277
87 Ga0466723_099458 3300042618 Bacteria 11666
88 Ga0466726_058110 3300042619 Bacteria 4415
89 Ga0466728_222702 3300042620 Bacteria 1814
90 Ga0123356_10000845 3300010049 Bacteria 34036
91 Ga0415639_066660 3300038395 Bacteria 2128
92 Ga0466692_048047 3300042591 Bacteria 3989
93 Ga0466691_031150 3300042593 Bacteria 4662
94 Ga0466691_099225 3300042593 Bacteria 1475
95 Ga0466696_015849 3300042596 Bacteria 7252
96 JGI24695J34938_10003360 3300002450 Bacteria 11256
97 JGI24695J34938_10007585 3300002450 Bacteria 6320
98 JGI24696J40584_12959003 3300002834 Bacteria 4622
99 Ga0466703_120133 3300042636 Bacteria 4553
100 Ga0466708_404322 3300042652 Bacteria 19003
101 Ga0466713_093794 3300042602 Bacteria 7185
102 Ga0466716_120217 3300042605 Bacteria 7207
103 Ga0466719_083823 3300042606 Bacteria 6365
104 Ga0466733_055671 3300042659 Bacteria 6304
105 Ga0466733_065487 3300042659 Bacteria 81466
106 Ga0466711_293871 3300042615 Bacteria 8103
107 Ga0466723_045365 3300042618 Bacteria 1344
108 Ga0466723_222971 3300042618 Unclassified 1833
109 Ga0466723_374462 3300042618 Bacteria 10686
110 Ga0466726_325945 3300042619 Bacteria 1035
111 Ga0466728_008465 3300042620 Bacteria 9263
112 Ga0466693_182738 3300042592 Bacteria 29264
113 Ga0466696_245549 3300042596 Bacteria 6815
114 JGI24695J34938_10001253 3300002450 Bacteria 22314
115 JGI24695J34938_10014034 3300002450 Bacteria 4176
116 Ga0466729_317435 3300042621 Bacteria 2695
117 Ga0466703_017391 3300042636 Bacteria 4253
118 Ga0466703_163513 3300042636 Bacteria 5035
119 Ga0466704_282781 3300042643 Bacteria 6244
120 Ga0466709_041638 3300042648 Bacteria 21871
121 Ga0466709_276639 3300042648 Bacteria 4042
122 Ga0466708_358745 3300042652 Bacteria 3905
123 Ga0466713_043357 3300042602 Unclassified 6021
124 Ga0466719_447412 3300042606 Bacteria 2526
125 Ga0466705_243227 3300042612 Bacteria 38943
126 Ga0466711_119610 3300042615 Bacteria 5118
127 Ga0466726_196688 3300042619 Bacteria 7912
128 Ga0466726_432747 3300042619 Bacteria 2256
129 Ga0466728_049676 3300042620 Bacteria 2739
130 Ga0466728_484661 3300042620 Bacteria 3358
131 Ga0456237_0003488 3300041968 Unclassified 2544
132 Ga0466690_005527 3300042590 Bacteria 5812
133 Ga0466690_219493 3300042590 Unclassified 10470
134 Ga0466699_306662 3300042597 Bacteria 9453
135 JGI24695J34938_10010878 3300002450 Bacteria 4942
136 Ga0466729_231556 3300042621 Bacteria 2180
137 Ga0466703_082926 3300042636 Bacteria 8432
138 Ga0466703_125329 3300042636 Bacteria 29013
139 Ga0466704_539296 3300042643 Bacteria 2489
140 Ga0466708_249161 3300042652 Bacteria 3005
141 Ga0466716_000847 3300042605 Bacteria 5335
142 Ga0466716_183556 3300042605 Bacteria 6108
143 Ga0466719_118007 3300042606 Bacteria 5027
144 Ga0466719_136883 3300042606 Bacteria 14654
145 Ga0466719_191499 3300042606 Bacteria 9204
146 Ga0466719_428653 3300042606 Bacteria 24145
147 Ga0466733_023888 3300042659 Unclassified 1942
148 Ga0466705_491740 3300042612 Bacteria 9390
149 Ga0466711_007322 3300042615 Bacteria 28586
150 Ga0466711_036779 3300042615 Bacteria 20641
151 Ga0466715_120511 3300042616 Bacteria 2951
152 Ga0466723_129157 3300042618 Bacteria 8106
153 Ga0466726_117306 3300042619 Bacteria 1745
154 Ga0466726_357067 3300042619 Bacteria 1248
155 Ga0466728_030597 3300042620 Bacteria 2785
156 Ga0466692_046434 3300042591 Bacteria 25458
157 AustNasuHG_c1016114 3300000089 Bacteria 2507
158 JGI24695J34938_10019929 3300002450 Bacteria 3311
159 Ga0466727_141521 3300042655 Bacteria 3409

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01263 Aldose_epim Aldose 1-epimerase 51 382 0.97

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.