Protein Family IF09136
Metagenome
Isolate
330
Members
263
Samples
143
Scaffolds
268.29
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_091843|Ga0466703_091843_2452_3384
- Length
- 310 aa
- Sequence
- MPGLVNPGLSGDGGKGWFSIRRIDEGVAGFGVYFQLKGGNMSAQASTRQLTHLDLAKMRASGERIAMLTCYDASFARLCDAAGVDVVLIGDSLGNVIQGHTSSLPVTLDDIIYHTRAVLRGCDRPLVAADMPVGTFQESPRLAYRNAVKLMAAGAQMVKIEGGVTMAATTRFLVERGVPVCAHIGLTPQSVHQFGGFRVQGKGDFAAQRFLDDAKAQEDAGAALIVFEAVPAHLGEEATRLLSIPTIGIGAGPSCSGQVLVLHDMLDIYPGRKPKFVRNFMEGQPGVAAALSAYVAAVKDGSFPGPEHCY
Sample Types
Isolate
56.7%
Metagenome
43.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
31.9%
Apidae
25.1%
Elmidae
5.2%
Kalotermitidae
4.8%
Culicidae
4.4%
Curculionidae
3.6%
Formicidae
3.6%
Unclassified
3.6%
Armadillidiidae
2.8%
Termitidae
2.8%
Drosophilidae
2.4%
Sarcophagidae
1.6%
Termopsidae
1.6%
Rhinotermitidae
1.2%
Aphididae
0.8%
Largidae
0.8%
Berytidae
0.8%
Alydidae
0.8%
Stratiomyidae
0.4%
Rhopalidae
0.4%
Passalidae
0.4%
Hodotermitidae
0.4%
Siricidae
0.4%
Bombycidae
0.4%
Taxonomy
Archaea
0
Bacteria
312
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 2 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 3 | 2831380896 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 4 | 2837560943 | Snodgrassella alvi HK3 | Isolate | Apidae |
| 5 | 2840743474 | Snodgrassella alvi N-23 | Isolate | Apidae |
| 6 | 2846366200 | Snodgrassella alvi Gris3-4 | Isolate | Apidae |
| 7 | 2846370940 | Snodgrassella alvi Nev3CBA3 | Isolate | Apidae |
| 8 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 9 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 10 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 11 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 12 | 3300000460 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O02 | Metagenome | Apidae |
| 13 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 14 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 15 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 16 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 17 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 18 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 19 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 20 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 21 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 22 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 23 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 24 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 25 | 8101255641 | Snodgrassella sp. M0110 | Isolate | Apidae |
| 26 | 8101260589 | Snodgrassella sp. M0118 | Isolate | Apidae |
| 27 | 8101267702 | Snodgrassella sp. W6238H14 | Isolate | Apidae |
| 28 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 29 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 30 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 31 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 32 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 33 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 34 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 35 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 36 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 37 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 38 | 2791354930 | Wohlfahrtiimonas larvae kbl006 | Isolate | Stratiomyidae |
| 39 | 2811994808 | Snodgrassella alvi Sa_196 v2 | Isolate | Unclassified |
| 40 | 2846361553 | Snodgrassella alvi PEB0171 | Isolate | Apidae |
| 41 | 2849417936 | Snodgrassella alvi N9 | Isolate | Apidae |
| 42 | 2852205774 | Snodgrassella alvi ESL0196 | Isolate | Apidae |
| 43 | 2854086477 | Snodgrassella alvi N-S3 | Isolate | Apidae |
| 44 | 2854097802 | Snodgrassella alvi Aw-18 | Isolate | Apidae |
| 45 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 46 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 47 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 48 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 49 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 50 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 51 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 52 | 8101265296 | Snodgrassella sp. W8158 | Isolate | Apidae |
| 53 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 54 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 55 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 56 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 57 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 58 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 59 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 60 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 61 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 62 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 63 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 64 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 65 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 66 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 67 | 2834412944 | Snodgrassella alvi A-5-24 | Isolate | Apidae |
| 68 | 2834415282 | Snodgrassella alvi Occ4-2 | Isolate | Apidae |
| 69 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 70 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 71 | 2857830159 | Snodgrassella alvi A-9-24 | Isolate | Apidae |
| 72 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 73 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 74 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 75 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 76 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 77 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 78 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 79 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 80 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 81 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 82 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 83 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 84 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 85 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 86 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 87 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 88 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 89 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 90 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 91 | 8101258116 | Snodgrassella sp. M0112 | Isolate | Apidae |
| 92 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 93 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 94 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 95 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 96 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 97 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 98 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 99 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 100 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 101 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 102 | 2684622927 | Snodgrassella alvi Sa_196 | Isolate | Unclassified |
| 103 | 2837563510 | Snodgrassella alvi N-S1 | Isolate | Apidae |
| 104 | 2843299038 | Snodgrassella alvi N-S2 | Isolate | Apidae |
| 105 | 2846368606 | Snodgrassella alvi A-11-12 | Isolate | Apidae |
| 106 | 2849404451 | Snodgrassella alvi E1 | Isolate | Apidae |
| 107 | 2854088767 | Snodgrassella alvi MS1-3 | Isolate | Apidae |
| 108 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 109 | 2857840086 | Snodgrassella alvi Aw-20 | Isolate | Apidae |
| 110 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 111 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 112 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 113 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 114 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 115 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 116 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 117 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 118 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 119 | 8065340634 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 120 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 121 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 122 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 123 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 124 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 125 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 126 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 127 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 128 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 129 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 130 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 131 | 2840748007 | Snodgrassella alvi A-1-12 | Isolate | Apidae |
| 132 | 2843301220 | Snodgrassella alvi Nev4-2 | Isolate | Apidae |
| 133 | 2846363972 | Snodgrassella alvi N-W7 | Isolate | Apidae |
| 134 | 2849406737 | Snodgrassella alvi PEB0178 | Isolate | Apidae |
| 135 | 2849415715 | Snodgrassella alvi A2 | Isolate | Apidae |
| 136 | 2857822956 | Snodgrassella alvi N-W4 | Isolate | Apidae |
| 137 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 138 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 139 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 140 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 141 | 3300007058 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut | Metagenome | Drosophilidae |
| 142 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 143 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 144 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 145 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 146 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 147 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 148 | 3300002451 | Arthropod gut microbial communities from Cuernavaca, Mexico - Contigs_Hibr_8mil | Metagenome | |
| 149 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 150 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 151 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 152 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 153 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 154 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 155 | 8101263066 | Snodgrassella sp. M0351 | Isolate | Apidae |
| 156 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 157 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 158 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 159 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 160 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 161 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 162 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 163 | 8119099601 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 164 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 165 | 2517487021 | Wohlfahrtiimonas chitiniclastica DSM 18708 | Isolate | Sarcophagidae |
| 166 | 2585428136 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 167 | 2854100132 | Snodgrassella alvi A-2-12 | Isolate | Apidae |
| 168 | 2857827427 | Snodgrassella alvi App6-4 | Isolate | Apidae |
| 169 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 170 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 171 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 172 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 173 | 3300000475 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-J21 | Metagenome | Apidae |
| 174 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 175 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 176 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 177 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 178 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 179 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 180 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 181 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 182 | 8101270055 | Snodgrassella sp. W8124 | Isolate | Apidae |
| 183 | 8101278866 | Snodgrassella sp. W6238H11 | Isolate | Apidae |
| 184 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 185 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 186 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 187 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 188 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 189 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 190 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 191 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 192 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 193 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 194 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 195 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 196 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 197 | 2846376288 | Snodgrassella alvi Fer4-2 | Isolate | Apidae |
| 198 | 2849399727 | Snodgrassella alvi Fer1-2 | Isolate | Apidae |
| 199 | 2849402121 | Snodgrassella alvi A-10-12 | Isolate | Apidae |
| 200 | 2849413536 | Snodgrassella alvi N-S4 | Isolate | Apidae |
| 201 | 2854095577 | Snodgrassella alvi A12 | Isolate | Apidae |
| 202 | 2857837414 | Snodgrassella alvi App4-8 | Isolate | Apidae |
| 203 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 204 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 205 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 206 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 207 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 208 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 209 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 210 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 211 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 212 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 213 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 214 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 215 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 216 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 217 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 218 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 219 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 220 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 221 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 222 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 223 | 8101272231 | Snodgrassella sp. W8132 | Isolate | Apidae |
| 224 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 225 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 226 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 227 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 228 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 229 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 230 | 2513237114 | Ignatzschineria larvae DSM 13226 | Isolate | Sarcophagidae |
| 231 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 232 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 233 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 234 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 235 | 2846373876 | Snodgrassella alvi Gris1-3 | Isolate | Apidae |
| 236 | 2848751009 | Snodgrassella alvi App2-2 | Isolate | Apidae |
| 237 | 2849411303 | Snodgrassella alvi A3 | Isolate | Apidae |
| 238 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 239 | 2854093395 | Snodgrassella alvi N-S5 | Isolate | Apidae |
| 240 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 241 | 2857835046 | Snodgrassella alvi wkB9 | Isolate | Apidae |
| 242 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 243 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 244 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 245 | 3300007136 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 4 gut | Metagenome | Drosophilidae |
| 246 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 247 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 248 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 249 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 250 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 251 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 252 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 253 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 254 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 255 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 256 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 257 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 258 | 8101274435 | Snodgrassella sp. W8134 | Isolate | Apidae |
| 259 | 8101276651 | Snodgrassella sp. W8135 | Isolate | Apidae |
| 260 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 261 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 262 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 263 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160440_100502 | 3300012815 | Bacteria | 12174 |
| 2 | Ga0160433_102293 | 3300012846 | Unclassified | 4231 |
| 3 | Ga0160443_100003 | 3300012848 | Bacteria | 802970 |
| 4 | Ga0160457_1000037 | 3300012858 | Bacteria | 225688 |
| 5 | Ga0466691_067916 | 3300042593 | Bacteria | 3970 |
| 6 | Ga0466696_184138 | 3300042596 | Bacteria | 4582 |
| 7 | DPO_contig00015 | 2032320009 | Bacteria | 16392 |
| 8 | DPOL_contig05673 | 2035918003 | Unclassified | 2333 |
| 9 | SPBB_contig11557 | 2044078006 | Bacteria | 42677 |
| 10 | FGTW_contig31410 | 2065487013 | Unclassified | 4524 |
| 11 | Ga0102739_1000041 | 3300007095 | Bacteria | 36435 |
| 12 | Ga0102738_1000104 | 3300007141 | Bacteria | 29514 |
| 13 | Ga0466726_313176 | 3300042619 | Bacteria | 4991 |
| 14 | Ga0466704_363902 | 3300042643 | Bacteria | 140929 |
| 15 | Ga0466727_110368 | 3300042655 | Bacteria | 37113 |
| 16 | Ga0466727_113548 | 3300042655 | Bacteria | 37011 |
| 17 | Ga0466713_054711 | 3300042602 | Bacteria | 3417 |
| 18 | Ga0466722_110717 | 3300042609 | Bacteria | 14790 |
| 19 | Ga0160453_100859 | 3300012814 | Unclassified | 15523 |
| 20 | Ga0160468_100722 | 3300012819 | Bacteria | 11227 |
| 21 | Ga0160444_100169 | 3300012841 | Bacteria | 63082 |
| 22 | Ga0160443_100245 | 3300012848 | Bacteria | 58038 |
| 23 | Ga0160447_107041 | 3300012849 | Bacteria | 2878 |
| 24 | Ga0160435_1000231 | 3300012857 | Bacteria | 26688 |
| 25 | Ga0466701_013902 | 3300042598 | Bacteria | 5186 |
| 26 | Ga0068305_10000188 | 3300005083 | Bacteria | 45611 |
| 27 | Ga0102734_1000044 | 3300007129 | Bacteria | 42041 |
| 28 | Ga0466726_182232 | 3300042619 | Bacteria | 5250 |
| 29 | Ga0466728_088434 | 3300042620 | Bacteria | 5690 |
| 30 | Ga0466724_36270 | 3300042649 | Bacteria | 39297 |
| 31 | Ga0466725_193527 | 3300042654 | Bacteria | 1475 |
| 32 | Ga0466727_067151 | 3300042655 | Bacteria | 68251 |
| 33 | Ga0466707_223776 | 3300042601 | Bacteria | 1793 |
| 34 | Ga0466716_311941 | 3300042605 | Bacteria | 1470 |
| 35 | Ga0466719_247805 | 3300042606 | Bacteria | 8709 |
| 36 | Ga0160456_103540 | 3300012820 | Bacteria | 2329 |
| 37 | Ga0160431_100606 | 3300012828 | Bacteria | 13369 |
| 38 | Ga0160444_100125 | 3300012841 | Bacteria | 82034 |
| 39 | Ga0160443_103440 | 3300012848 | Bacteria | 2757 |
| 40 | Ga0160430_100167 | 3300012852 | Bacteria | 49602 |
| 41 | Ga0466657_291701 | 3300042582 | Bacteria | 18629 |
| 42 | Ga0466657_295292 | 3300042582 | Bacteria | 36314 |
| 43 | Ga0104048_1001248 | 3300007143 | Bacteria | 17721 |
| 44 | Ga0104019_1002240 | 3300007150 | Bacteria | 7459 |
| 45 | Ga0466715_139335 | 3300042616 | Bacteria | 2972 |
| 46 | Ga0466723_303021 | 3300042618 | Bacteria | 2997 |
| 47 | Ga0466726_042892 | 3300042619 | Bacteria | 13896 |
| 48 | Ga0160442_100403 | 3300012806 | Unclassified | 15444 |
| 49 | Ga0466705_120709 | 3300042612 | Bacteria | 20150 |
| 50 | Ga0466735_155691 | 3300042624 | Bacteria | 3257 |
| 51 | Ga0466701_076943 | 3300042598 | Bacteria | 1436 |
| 52 | Ga0466701_097219 | 3300042598 | Bacteria | 2231 |
| 53 | Ga0466707_245694 | 3300042601 | Bacteria | 2346 |
| 54 | Ga0466722_079114 | 3300042609 | Bacteria | 1498 |
| 55 | Ga0160459_100558 | 3300012831 | Unclassified | 13774 |
| 56 | Ga0160460_100330 | 3300012845 | Bacteria | 33935 |
| 57 | Ga0160433_100090 | 3300012846 | Bacteria | 92891 |
| 58 | Ga0160434_105620 | 3300012850 | Unclassified | 2079 |
| 59 | Ga0160436_1003246 | 3300012861 | Unclassified | 3995 |
| 60 | Ga0466701_007469 | 3300042598 | Bacteria | 67864 |
| 61 | DPOL_contig17876 | 2035918003 | Unclassified | 21241 |
| 62 | SPBB_contig01205 | 2044078006 | Unclassified | 765 |
| 63 | Ga0068302_10001520 | 3300005071 | Bacteria | 6973 |
| 64 | Ga0104043_1094851 | 3300007058 | Bacteria | 1026 |
| 65 | Ga0103260_1000174 | 3300007139 | Bacteria | 14357 |
| 66 | Ga0466715_143337 | 3300042616 | Bacteria | 5738 |
| 67 | Ga0466715_513140 | 3300042616 | Bacteria | 19563 |
| 68 | Ga0466723_303613 | 3300042618 | Bacteria | 7142 |
| 69 | Ga0466705_266002 | 3300042612 | Bacteria | 10169 |
| 70 | Ga0466729_251647 | 3300042621 | Bacteria | 5790 |
| 71 | Ga0466735_074875 | 3300042624 | Bacteria | 1984 |
| 72 | Ga0466703_428485 | 3300042636 | Bacteria | 2332 |
| 73 | Ga0466725_046375 | 3300042654 | Bacteria | 2936 |
| 74 | Ga0466701_018917 | 3300042598 | Bacteria | 69268 |
| 75 | Ga0466716_338988 | 3300042605 | Bacteria | 1673 |
| 76 | Ga0466719_382667 | 3300042606 | Bacteria | 1659 |
| 77 | Ga0466722_065373 | 3300042609 | Bacteria | 9045 |
| 78 | Ga0160470_100324 | 3300012813 | Unclassified | 26542 |
| 79 | Ga0160455_100038 | 3300012837 | Bacteria | 295540 |
| 80 | Ga0160455_100041 | 3300012837 | Bacteria | 272793 |
| 81 | Ga0160455_100332 | 3300012837 | Bacteria | 28556 |
| 82 | Ga0160457_1021713 | 3300012858 | Unclassified | 898 |
| 83 | Ga0466696_083098 | 3300042596 | Bacteria | 14835 |
| 84 | Ga0466696_489662 | 3300042596 | Bacteria | 2071 |
| 85 | IMNBGM34_c000176 | 3300000036 | Bacteria | 18995 |
| 86 | Vshibr_100500 | 3300002451 | Bacteria | 1200 |
| 87 | CVPL010W_10000204 | 3300002931 | Bacteria | 53621 |
| 88 | Ga0103263_100002 | 3300007042 | Bacteria | 79794 |
| 89 | Ga0104019_1190715 | 3300007150 | Bacteria | 2167 |
| 90 | Ga0466711_276173 | 3300042615 | Bacteria | 8364 |
| 91 | Ga0123356_10143989 | 3300010049 | Bacteria | 2355 |
| 92 | Ga0466704_025032 | 3300042643 | Bacteria | 1729 |
| 93 | Ga0466724_02372 | 3300042649 | Bacteria | 19633 |
| 94 | Ga0466724_26759 | 3300042649 | Bacteria | 20232 |
| 95 | Ga0466708_183827 | 3300042652 | Bacteria | 7859 |
| 96 | Ga0466725_177304 | 3300042654 | Bacteria | 72046 |
| 97 | Ga0466725_333702 | 3300042654 | Bacteria | 35725 |
| 98 | Ga0466727_270329 | 3300042655 | Bacteria | 2876 |
| 99 | Ga0466706_231850 | 3300042599 | Bacteria | 2279 |
| 100 | Ga0466707_324465 | 3300042601 | Bacteria | 13077 |
| 101 | Ga0466692_094217 | 3300042591 | Bacteria | 10378 |
| 102 | SWWA_contig31676__length_20737___numreads_1160 | 2100351016 | Bacteria | 20737 |
| 103 | SWWA_contig32035__length_2845___numreads_46 | 2100351016 | Unclassified | 2845 |
| 104 | Meta3P_1004182 | 3300002464 | Bacteria | 11894 |
| 105 | Ga0102740_1000289 | 3300007140 | Unclassified | 14323 |
| 106 | Ga0104019_1199111 | 3300007150 | Bacteria | 987 |
| 107 | Ga0105005_1031796 | 3300007505 | Bacteria | 56692 |
| 108 | Ga0466705_396062 | 3300042612 | Bacteria | 33926 |
| 109 | Ga0466710_284635 | 3300042613 | Bacteria | 31816 |
| 110 | Ga0160465_100008 | 3300012803 | Bacteria | 363413 |
| 111 | Ga0466705_230967 | 3300042612 | Bacteria | 25847 |
| 112 | Ga0466703_091843 | 3300042636 | Bacteria | 4093 |
| 113 | Ga0466716_249901 | 3300042605 | Bacteria | 3266 |
| 114 | Ga0466722_077673 | 3300042609 | Bacteria | 46854 |
| 115 | Ga0160460_100564 | 3300012845 | Bacteria | 19961 |
| 116 | Ga0160434_100397 | 3300012850 | Unclassified | 13016 |
| 117 | Ga0466696_120943 | 3300042596 | Bacteria | 22410 |
| 118 | DPO_contig08773 | 2032320009 | Unclassified | 7151 |
| 119 | SPBB_contig11545 | 2044078006 | Bacteria | 49416 |
| 120 | SCG598O02_11477 | 3300000460 | Bacteria | 22561 |
| 121 | Ga0072941_1358761 | 3300005201 | Bacteria | 1416 |
| 122 | Ga0102736_1000015 | 3300007052 | Bacteria | 102561 |
| 123 | Ga0103261_1000078 | 3300007083 | Bacteria | 42718 |
| 124 | Ga0104044_1149064 | 3300007136 | Bacteria | 1172 |
| 125 | Ga0105005_1094669 | 3300007505 | Bacteria | 1546 |
| 126 | Ga0466729_065080 | 3300042621 | Bacteria | 9829 |
| 127 | Ga0466730_025420 | 3300042625 | Bacteria | 17676 |
| 128 | Ga0466704_301760 | 3300042643 | Bacteria | 14070 |
| 129 | Ga0466701_069106 | 3300042598 | Bacteria | 36048 |
| 130 | Ga0466701_076719 | 3300042598 | Bacteria | 51291 |
| 131 | Ga0160446_100155 | 3300012835 | Bacteria | 54491 |
| 132 | Ga0160460_103002 | 3300012845 | Bacteria | 3264 |
| 133 | Ga0160447_104235 | 3300012849 | Bacteria | 4313 |
| 134 | Ga0160448_102196 | 3300012854 | Unclassified | 6104 |
| 135 | Ga0466701_008886 | 3300042598 | Bacteria | 1776 |
| 136 | SCG598J21_11567 | 3300000475 | Bacteria | 39151 |
| 137 | Ga0104041_1114203 | 3300007106 | Bacteria | 1474 |
| 138 | Ga0466728_453269 | 3300042620 | Bacteria | 3978 |
| 139 | Ga0466735_005029 | 3300042624 | Bacteria | 29669 |
| 140 | Ga0466724_31075 | 3300042649 | Bacteria | 13821 |
| 141 | Ga0466724_31627 | 3300042649 | Unclassified | 18767 |
| 142 | Ga0466727_205025 | 3300042655 | Bacteria | 1813 |
| 143 | Ga0466706_031300 | 3300042599 | Bacteria | 209681 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02548 | Pantoate_transf | Ketopantoate hydroxymethyltransferase | 51 | 305 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.