Protein Family IF09122
Metagenome
Isolate
158
Members
41
Samples
154
Scaffolds
265.12
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_065803|Ga0466703_065803_7132_7998
- Length
- 288 aa
- Sequence
- MNIALIGYGKMGRILERTALERGHRVAAVVDPFVSGFPTGSGAPLYTTIAEWTRLSGAGNSAEGGVDVAVEFTRPDTAVENIRALIEGGIPTVAGTTGWYDHLKEIETLAGEKKGSFCWSSNYSLGVNLFYRIAAFAAKLSDPFPEYDVGGWEFHHNKKIDSPSGTAKILVEKILAVMTRKKKAVWEKLNRPPAPDELHFPSLRLGSIPGVHAVCFDSPSDTIEITHTGRSRDGLALGAIRAAEWLVNCPGPGKSAGSARSGVFTIDDVMEDILKAAVLPLTGFAAER
Sample Types
Isolate
2.5%
Metagenome
97.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.9%
Kalotermitidae
35.9%
Unclassified
12.8%
Rhinotermitidae
7.7%
Termopsidae
7.7%
Taxonomy
Archaea
1
Bacteria
152
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 4 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 5 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 6 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 7 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 8 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 9 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 10 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 17 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 20 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 21 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 22 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 23 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 24 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 25 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 26 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 27 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 28 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 29 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 30 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 35 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 36 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 37 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 38 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 39 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 40 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 41 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10020536 | 3300009826 | Bacteria | 10553 |
| 2 | Ga0466731_299879 | 3300042622 | Bacteria | 1501 |
| 3 | Ga0466704_221950 | 3300042643 | Bacteria | 12708 |
| 4 | Ga0466704_248035 | 3300042643 | Bacteria | 1290 |
| 5 | Ga0466709_259608 | 3300042648 | Bacteria | 8752 |
| 6 | Ga0466708_013013 | 3300042652 | Bacteria | 5360 |
| 7 | Ga0466712_082466 | 3300042614 | Bacteria | 1229 |
| 8 | Ga0466715_154919 | 3300042616 | Bacteria | 14311 |
| 9 | Ga0466723_088657 | 3300042618 | Bacteria | 4001 |
| 10 | Ga0466723_194702 | 3300042618 | Bacteria | 2682 |
| 11 | Ga0466690_042215 | 3300042590 | Bacteria | 4853 |
| 12 | Ga0466690_401174 | 3300042590 | Bacteria | 1137 |
| 13 | Ga0466691_116209 | 3300042593 | Bacteria | 16837 |
| 14 | Ga0466720_117641 | 3300042607 | Bacteria | 10871 |
| 15 | JGI24698J34947_10002680 | 3300002449 | Bacteria | 9605 |
| 16 | JGI24698J34947_10015927 | 3300002449 | Bacteria | 4088 |
| 17 | JGI24698J34947_10051724 | 3300002449 | Bacteria | 2064 |
| 18 | JGI24695J34938_10005531 | 3300002450 | Bacteria | 7846 |
| 19 | Ga0466705_349749 | 3300042612 | Unclassified | 4780 |
| 20 | Ga0123356_10000406 | 3300010049 | Bacteria | 48995 |
| 21 | Ga0466704_209487 | 3300042643 | Bacteria | 45601 |
| 22 | Ga0466704_341458 | 3300042643 | Bacteria | 9781 |
| 23 | Ga0466723_105383 | 3300042618 | Bacteria | 2799 |
| 24 | Ga0264413_106803 | 3300024493 | Bacteria | 9303 |
| 25 | Ga0466691_014861 | 3300042593 | Bacteria | 3481 |
| 26 | Ga0466694_203898 | 3300042594 | Bacteria | 15560 |
| 27 | Ga0466696_143907 | 3300042596 | Bacteria | 1086 |
| 28 | Ga0466696_210894 | 3300042596 | Bacteria | 3802 |
| 29 | Ga0466699_079848 | 3300042597 | Bacteria | 2599 |
| 30 | Ga0466707_341621 | 3300042601 | Bacteria | 1173 |
| 31 | Ga0466719_331483 | 3300042606 | Bacteria | 2190 |
| 32 | Ga0466720_006499 | 3300042607 | Bacteria | 7160 |
| 33 | JGI24698J34947_10017715 | 3300002449 | Bacteria | 3857 |
| 34 | JGI24695J34938_10007095 | 3300002450 | Bacteria | 6622 |
| 35 | Ga0466705_351091 | 3300042612 | Bacteria | 6034 |
| 36 | Ga0466732_435157 | 3300042656 | Bacteria | 1841 |
| 37 | Ga0466735_036030 | 3300042624 | Bacteria | 1735 |
| 38 | Ga0466727_243069 | 3300042655 | Bacteria | 1169 |
| 39 | Ga0466712_285185 | 3300042614 | Bacteria | 2141 |
| 40 | Ga0466723_239088 | 3300042618 | Bacteria | 4312 |
| 41 | Ga0466728_020618 | 3300042620 | Bacteria | 3906 |
| 42 | Ga0466728_044083 | 3300042620 | Bacteria | 2196 |
| 43 | Ga0466690_184731 | 3300042590 | Bacteria | 8122 |
| 44 | Ga0466694_221018 | 3300042594 | Bacteria | 1878 |
| 45 | Ga0466696_252281 | 3300042596 | Bacteria | 2991 |
| 46 | Ga0466716_221761 | 3300042605 | Bacteria | 1907 |
| 47 | Ga0466719_048724 | 3300042606 | Bacteria | 3149 |
| 48 | Ga0466719_094719 | 3300042606 | Bacteria | 35699 |
| 49 | Ga0466719_284785 | 3300042606 | Bacteria | 11553 |
| 50 | Ga0466720_173735 | 3300042607 | Bacteria | 1826 |
| 51 | Ga0466720_174969 | 3300042607 | Bacteria | 8823 |
| 52 | JGI24698J34947_10011249 | 3300002449 | Bacteria | 4913 |
| 53 | JGI24698J34947_10100294 | 3300002449 | Unclassified | 1304 |
| 54 | Ga0466705_046514 | 3300042612 | Bacteria | 4407 |
| 55 | Ga0466732_339863 | 3300042656 | Bacteria | 3834 |
| 56 | Ga0466703_053982 | 3300042636 | Bacteria | 35406 |
| 57 | Ga0466709_140248 | 3300042648 | Bacteria | 7448 |
| 58 | Ga0466708_023393 | 3300042652 | Bacteria | 3961 |
| 59 | Ga0466715_086582 | 3300042616 | Bacteria | 6630 |
| 60 | Ga0466715_174577 | 3300042616 | Bacteria | 2974 |
| 61 | Ga0466715_270970 | 3300042616 | Bacteria | 3036 |
| 62 | Ga0466728_078215 | 3300042620 | Bacteria | 4596 |
| 63 | Ga0466716_066787 | 3300042605 | Bacteria | 4976 |
| 64 | Ga0466716_247787 | 3300042605 | Bacteria | 10104 |
| 65 | Ga0466720_040240 | 3300042607 | Bacteria | 13976 |
| 66 | AustNasuHG_c1000196 | 3300000089 | Bacteria | 19966 |
| 67 | JGI24698J34947_10066139 | 3300002449 | Bacteria | 1759 |
| 68 | Ga0072941_1005893 | 3300005201 | Bacteria | 13274 |
| 69 | Ga0466705_108985 | 3300042612 | Bacteria | 1066 |
| 70 | Ga0466705_138823 | 3300042612 | Bacteria | 3705 |
| 71 | Ga0466709_412505 | 3300042648 | Bacteria | 1792 |
| 72 | Ga0466727_069864 | 3300042655 | Bacteria | 1900 |
| 73 | Ga0466705_488971 | 3300042612 | Bacteria | 7617 |
| 74 | Ga0466712_153651 | 3300042614 | Bacteria | 1918 |
| 75 | Ga0466712_246164 | 3300042614 | Bacteria | 1105 |
| 76 | Ga0466723_304311 | 3300042618 | Bacteria | 3892 |
| 77 | Ga0466726_469940 | 3300042619 | Bacteria | 3157 |
| 78 | Ga0466728_063252 | 3300042620 | Bacteria | 5206 |
| 79 | Ga0264413_122423 | 3300024493 | Bacteria | 10407 |
| 80 | Ga0466690_152887 | 3300042590 | Bacteria | 11754 |
| 81 | Ga0466700_299947 | 3300042600 | Bacteria | 2477 |
| 82 | Ga0466707_176047 | 3300042601 | Bacteria | 1631 |
| 83 | Ga0466720_023154 | 3300042607 | Bacteria | 31720 |
| 84 | Ga0466720_069212 | 3300042607 | Bacteria | 9347 |
| 85 | Ga0466720_149801 | 3300042607 | Bacteria | 12041 |
| 86 | Ga0466720_153295 | 3300042607 | Bacteria | 2950 |
| 87 | Ga0466720_218634 | 3300042607 | Bacteria | 1144 |
| 88 | JGI24698J34947_10057290 | 3300002449 | Bacteria | 1934 |
| 89 | Ga0123356_10013022 | 3300010049 | Bacteria | 8047 |
| 90 | Ga0466703_232321 | 3300042636 | Bacteria | 6019 |
| 91 | Ga0466704_232614 | 3300042643 | Bacteria | 2322 |
| 92 | Ga0466708_109511 | 3300042652 | Bacteria | 32313 |
| 93 | Ga0466708_464475 | 3300042652 | Bacteria | 69222 |
| 94 | Ga0466712_081472 | 3300042614 | Bacteria | 9937 |
| 95 | Ga0466712_204971 | 3300042614 | Bacteria | 1740 |
| 96 | Ga0466715_098690 | 3300042616 | Bacteria | 13525 |
| 97 | Ga0466715_260123 | 3300042616 | Bacteria | 6541 |
| 98 | Ga0466723_006517 | 3300042618 | Bacteria | 14855 |
| 99 | Ga0466723_096020 | 3300042618 | Bacteria | 11191 |
| 100 | Ga0466728_049517 | 3300042620 | Bacteria | 2814 |
| 101 | Ga0264413_115566 | 3300024493 | Bacteria | 11298 |
| 102 | Ga0466691_005002 | 3300042593 | Bacteria | 2350 |
| 103 | Ga0466691_025299 | 3300042593 | Bacteria | 2691 |
| 104 | Ga0466691_120345 | 3300042593 | Bacteria | 13092 |
| 105 | Ga0466696_082242 | 3300042596 | Bacteria | 11475 |
| 106 | Ga0466707_261228 | 3300042601 | Bacteria | 1109 |
| 107 | Ga0466707_279247 | 3300042601 | Bacteria | 3144 |
| 108 | Ga0466719_096424 | 3300042606 | Bacteria | 2228 |
| 109 | Ga0466720_009999 | 3300042607 | Unclassified | 10463 |
| 110 | Ga0466720_011873 | 3300042607 | Bacteria | 1073 |
| 111 | Ga0466720_186658 | 3300042607 | Bacteria | 1754 |
| 112 | Ga0466720_233106 | 3300042607 | Bacteria | 42880 |
| 113 | Ga0466722_211545 | 3300042609 | Bacteria | 2743 |
| 114 | Ga0072941_1010098 | 3300005201 | Bacteria | 12642 |
| 115 | Ga0466729_307080 | 3300042621 | Bacteria | 1770 |
| 116 | Ga0466735_198670 | 3300042624 | Bacteria | 1399 |
| 117 | Ga0466703_065803 | 3300042636 | Bacteria | 8199 |
| 118 | Ga0466709_075030 | 3300042648 | Bacteria | 18734 |
| 119 | Ga0466709_101846 | 3300042648 | Bacteria | 4145 |
| 120 | Ga0466708_077544 | 3300042652 | Bacteria | 7996 |
| 121 | Ga0466708_389577 | 3300042652 | Bacteria | 54586 |
| 122 | Ga0466727_149806 | 3300042655 | Bacteria | 3399 |
| 123 | Ga0466715_357417 | 3300042616 | Bacteria | 1057 |
| 124 | Ga0466718_103258 | 3300042617 | Bacteria | 5595 |
| 125 | Ga0466723_155358 | 3300042618 | Bacteria | 3217 |
| 126 | Ga0466723_160805 | 3300042618 | Bacteria | 4966 |
| 127 | Ga0466723_196144 | 3300042618 | Bacteria | 3170 |
| 128 | Ga0466723_298435 | 3300042618 | Bacteria | 4343 |
| 129 | Ga0456237_0016775 | 3300041968 | Unclassified | 1031 |
| 130 | Ga0466699_061473 | 3300042597 | Bacteria | 1422 |
| 131 | Ga0466699_291512 | 3300042597 | Archaea | 1286 |
| 132 | Ga0466707_365356 | 3300042601 | Bacteria | 1771 |
| 133 | Ga0466716_439008 | 3300042605 | Bacteria | 5531 |
| 134 | Ga0466719_390155 | 3300042606 | Bacteria | 1311 |
| 135 | Ga0466720_077344 | 3300042607 | Bacteria | 10091 |
| 136 | JGI24698J34947_10029868 | 3300002449 | Bacteria | 2877 |
| 137 | Ga0466705_038488 | 3300042612 | Bacteria | 5264 |
| 138 | Ga0123353_10941268 | 3300010167 | Bacteria | 1170 |
| 139 | Ga0466735_035377 | 3300042624 | Bacteria | 6944 |
| 140 | Ga0466703_010863 | 3300042636 | Bacteria | 38457 |
| 141 | Ga0466703_214854 | 3300042636 | Bacteria | 3697 |
| 142 | Ga0466704_592132 | 3300042643 | Bacteria | 1814 |
| 143 | Ga0466708_024450 | 3300042652 | Bacteria | 2973 |
| 144 | Ga0466712_022854 | 3300042614 | Bacteria | 2884 |
| 145 | Ga0466712_235450 | 3300042614 | Unclassified | 1382 |
| 146 | Ga0466711_278536 | 3300042615 | Bacteria | 2764 |
| 147 | Ga0466729_129073 | 3300042621 | Bacteria | 1135 |
| 148 | Ga0264413_121020 | 3300024493 | Bacteria | 1509 |
| 149 | Ga0466691_102279 | 3300042593 | Bacteria | 4705 |
| 150 | Ga0466691_106456 | 3300042593 | Bacteria | 7416 |
| 151 | Ga0466707_086845 | 3300042601 | Bacteria | 1154 |
| 152 | Ga0466707_405867 | 3300042601 | Bacteria | 2915 |
| 153 | JGI24698J34947_10003594 | 3300002449 | Bacteria | 8423 |
| 154 | JGI24695J34938_10003647 | 3300002450 | Bacteria | 10567 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.