Protein Family IF09105
Metagenome
Metatranscriptome
Isolate
147
Members
43
Samples
142
Scaffolds
259
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_041270|Ga0466703_041270_11465_12340
- Length
- 291 aa
- Sequence
- MSSGNSGAPGSRGFFEGGLTRIFKRSGGAAEPAGPAPDTGEEQESPPLDRKILAALNSDQREMVRGIADLSDTTVKEVMVPRIDTVFLSVEASRDELLDRIAESEHSRFPVYQDTIDNVIGILYVKDVLRSLVKNENFDVVKLLRKPFFVPLSKRIDGLLRELRRRRVHIAVVVDEYGGVSGIACMEDIIEEIVGDIQDEFDHETEDLLKLGEGIWLCDARLNLEDLSQKIGVDLPVESFDTLGGFVFDLFGKIPVCYEKAVYRGNDFIIHNMDGHKINTVKIVLHSEEGP
Sample Types
Isolate
3.4%
Metagenome
95.9%
MAG
0.0%
Metatranscriptome
0.7%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
35.0%
Termitidae
30.0%
Unclassified
17.5%
Termopsidae
7.5%
Rhinotermitidae
5.0%
Hodotermitidae
2.5%
Blaberidae
2.5%
Taxonomy
Archaea
0
Bacteria
140
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 3 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 4 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 5 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 6 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 7 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 8 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 9 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 13 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 14 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 17 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 18 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 19 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 22 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 23 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 24 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 25 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 26 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 27 | 2820025825 | Unclassified Spirochaetes Lab288P1bin8 | Isolate | Unclassified |
| 28 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 29 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 30 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 31 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 32 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 33 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 34 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 35 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 36 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 37 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 38 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 39 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123353_10063734 | 3300010167 | Bacteria | 5912 |
| 2 | JGI24698J34947_10004303 | 3300002449 | Bacteria | 7749 |
| 3 | JGI24698J34947_10009458 | 3300002449 | Bacteria | 5349 |
| 4 | Ga0068305_10037418 | 3300005083 | Bacteria | 10822 |
| 5 | Ga0466712_260719 | 3300042614 | Bacteria | 20517 |
| 6 | Ga0466715_016266 | 3300042616 | Bacteria | 6832 |
| 7 | Ga0466715_540587 | 3300042616 | Bacteria | 1776 |
| 8 | Ga0466723_071898 | 3300042618 | Bacteria | 30989 |
| 9 | Ga0466723_255771 | 3300042618 | Bacteria | 84056 |
| 10 | Ga0466726_283753 | 3300042619 | Bacteria | 6034 |
| 11 | Ga0466728_291121 | 3300042620 | Bacteria | 1165 |
| 12 | Ga0466690_195937 | 3300042590 | Bacteria | 7101 |
| 13 | Ga0466691_132898 | 3300042593 | Bacteria | 10056 |
| 14 | Ga0466695_303664 | 3300042595 | Bacteria | 2905 |
| 15 | Ga0466703_110442 | 3300042636 | Bacteria | 41999 |
| 16 | Ga0466708_010042 | 3300042652 | Bacteria | 27601 |
| 17 | Ga0466706_215655 | 3300042599 | Bacteria | 1421 |
| 18 | Ga0466707_312716 | 3300042601 | Bacteria | 1613 |
| 19 | Ga0466719_114180 | 3300042606 | Bacteria | 19353 |
| 20 | Ga0466722_063760 | 3300042609 | Bacteria | 8858 |
| 21 | Ga0466722_136820 | 3300042609 | Bacteria | 12741 |
| 22 | Ga0466722_223518 | 3300042609 | Bacteria | 4850 |
| 23 | Ga0123356_10201563 | 3300010049 | Bacteria | 2030 |
| 24 | Ga0123353_10067080 | 3300010167 | Bacteria | 5761 |
| 25 | Ga0466712_266336 | 3300042614 | Bacteria | 1503 |
| 26 | Ga0466715_177196 | 3300042616 | Bacteria | 13055 |
| 27 | Ga0466715_242352 | 3300042616 | Bacteria | 2199 |
| 28 | Ga0466726_404177 | 3300042619 | Bacteria | 25452 |
| 29 | Ga0466696_170180 | 3300042596 | Bacteria | 28492 |
| 30 | Ga0466735_231369 | 3300042624 | Bacteria | 1191 |
| 31 | Ga0466704_102605 | 3300042643 | Bacteria | 24428 |
| 32 | Ga0466704_140776 | 3300042643 | Bacteria | 46136 |
| 33 | Ga0466704_247802 | 3300042643 | Bacteria | 5063 |
| 34 | Ga0466708_164685 | 3300042652 | Bacteria | 38582 |
| 35 | Ga0466722_039646 | 3300042609 | Bacteria | 15269 |
| 36 | Ga0466722_144296 | 3300042609 | Bacteria | 7214 |
| 37 | Ga0466722_151628 | 3300042609 | Bacteria | 7338 |
| 38 | Ga0466733_198067 | 3300042659 | Bacteria | 2663 |
| 39 | Ga0123355_10059231 | 3300009826 | Bacteria | 6191 |
| 40 | JGI24698J34947_10055585 | 3300002449 | Bacteria | 1971 |
| 41 | Ga0466711_044057 | 3300042615 | Bacteria | 8901 |
| 42 | Ga0466711_199744 | 3300042615 | Bacteria | 1088 |
| 43 | Ga0466715_359022 | 3300042616 | Bacteria | 1973 |
| 44 | Ga0466718_133009 | 3300042617 | Bacteria | 4904 |
| 45 | Ga0466723_127581 | 3300042618 | Bacteria | 4407 |
| 46 | Ga0466723_202240 | 3300042618 | Bacteria | 23395 |
| 47 | Ga0466726_261326 | 3300042619 | Bacteria | 8266 |
| 48 | Ga0466726_301919 | 3300042619 | Bacteria | 3079 |
| 49 | Ga0223674_1039998 | 3300021235 | Bacteria | 1359 |
| 50 | Ga0466690_391862 | 3300042590 | Unclassified | 2081 |
| 51 | Ga0466692_006030 | 3300042591 | Bacteria | 17726 |
| 52 | Ga0466692_176791 | 3300042591 | Bacteria | 13758 |
| 53 | Ga0466694_197503 | 3300042594 | Bacteria | 3668 |
| 54 | Ga0466696_129745 | 3300042596 | Bacteria | 25058 |
| 55 | Ga0466703_200059 | 3300042636 | Bacteria | 18485 |
| 56 | Ga0466709_267518 | 3300042648 | Bacteria | 6617 |
| 57 | Ga0466708_083190 | 3300042652 | Bacteria | 7723 |
| 58 | Ga0466727_063694 | 3300042655 | Unclassified | 1119 |
| 59 | Ga0466707_239817 | 3300042601 | Bacteria | 2218 |
| 60 | Ga0123353_10090535 | 3300010167 | Bacteria | 4926 |
| 61 | JGI24698J34947_10001351 | 3300002449 | Bacteria | 12896 |
| 62 | JGI24698J34947_10129497 | 3300002449 | Bacteria | 1081 |
| 63 | Ga0068305_10003169 | 3300005083 | Unclassified | 3295 |
| 64 | Ga0466711_023770 | 3300042615 | Bacteria | 2388 |
| 65 | Ga0466711_038973 | 3300042615 | Bacteria | 29172 |
| 66 | Ga0466715_578351 | 3300042616 | Bacteria | 17317 |
| 67 | Ga0466718_112041 | 3300042617 | Bacteria | 1302 |
| 68 | Ga0466726_284985 | 3300042619 | Bacteria | 2230 |
| 69 | Ga0466728_031070 | 3300042620 | Bacteria | 1484 |
| 70 | Ga0466731_343864 | 3300042622 | Bacteria | 2460 |
| 71 | Ga0466703_146349 | 3300042636 | Bacteria | 1993 |
| 72 | Ga0466727_010861 | 3300042655 | Bacteria | 2868 |
| 73 | Ga0466716_501287 | 3300042605 | Bacteria | 1522 |
| 74 | Ga0466722_192504 | 3300042609 | Bacteria | 17517 |
| 75 | Ga0466722_243657 | 3300042609 | Bacteria | 9955 |
| 76 | Ga0466698_110672 | 3300042610 | Bacteria | 1835 |
| 77 | Ga0466733_175294 | 3300042659 | Bacteria | 1791 |
| 78 | Ga0123356_10624715 | 3300010049 | Bacteria | 1243 |
| 79 | JGI24698J34947_10067324 | 3300002449 | Bacteria | 1738 |
| 80 | JGI24698J34947_10117074 | 3300002449 | Bacteria | 1164 |
| 81 | Ga0466726_098931 | 3300042619 | Bacteria | 11089 |
| 82 | Ga0466726_326835 | 3300042619 | Bacteria | 6427 |
| 83 | Ga0466726_359327 | 3300042619 | Bacteria | 15666 |
| 84 | Ga0466726_463099 | 3300042619 | Bacteria | 1756 |
| 85 | Ga0466728_066942 | 3300042620 | Bacteria | 22999 |
| 86 | Ga0466691_052772 | 3300042593 | Bacteria | 8473 |
| 87 | Ga0466696_445111 | 3300042596 | Unclassified | 2205 |
| 88 | Ga0466735_149400 | 3300042624 | Bacteria | 1459 |
| 89 | Ga0466703_382712 | 3300042636 | Bacteria | 2516 |
| 90 | Ga0466704_350973 | 3300042643 | Bacteria | 2977 |
| 91 | Ga0466709_067178 | 3300042648 | Bacteria | 17391 |
| 92 | Ga0466727_238967 | 3300042655 | Unclassified | 1475 |
| 93 | Ga0466719_515378 | 3300042606 | Bacteria | 4834 |
| 94 | Ga0466719_552202 | 3300042606 | Unclassified | 1760 |
| 95 | Ga0466705_338767 | 3300042612 | Bacteria | 4588 |
| 96 | Ga0123353_10249689 | 3300010167 | Bacteria | 2749 |
| 97 | JGI24698J34947_10000638 | 3300002449 | Bacteria | 16920 |
| 98 | Ga0072941_1001487 | 3300005201 | Bacteria | 51851 |
| 99 | Ga0466705_419597 | 3300042612 | Bacteria | 2305 |
| 100 | Ga0466723_017518 | 3300042618 | Bacteria | 33403 |
| 101 | Ga0466723_228640 | 3300042618 | Bacteria | 18419 |
| 102 | Ga0466728_358911 | 3300042620 | Bacteria | 19107 |
| 103 | Ga0466691_021581 | 3300042593 | Bacteria | 18132 |
| 104 | Ga0466696_108305 | 3300042596 | Bacteria | 9691 |
| 105 | Ga0466704_156418 | 3300042643 | Unclassified | 4011 |
| 106 | Ga0466708_072672 | 3300042652 | Bacteria | 1023 |
| 107 | Ga0466719_135362 | 3300042606 | Bacteria | 51759 |
| 108 | Ga0466698_508212 | 3300042610 | Bacteria | 1253 |
| 109 | Ga0466705_284742 | 3300042612 | Bacteria | 4788 |
| 110 | Ga0123356_10726006 | 3300010049 | Bacteria | 1163 |
| 111 | Ga0123353_10606662 | 3300010167 | Bacteria | 1563 |
| 112 | Ga0123353_10659274 | 3300010167 | Bacteria | 1479 |
| 113 | Ga0466711_038496 | 3300042615 | Bacteria | 33651 |
| 114 | Ga0466711_159576 | 3300042615 | Bacteria | 11076 |
| 115 | Ga0466715_504706 | 3300042616 | Bacteria | 1421 |
| 116 | Ga0466718_000723 | 3300042617 | Bacteria | 16742 |
| 117 | Ga0466723_058149 | 3300042618 | Bacteria | 34327 |
| 118 | Ga0466726_153394 | 3300042619 | Bacteria | 7581 |
| 119 | Ga0264413_117084 | 3300024493 | Bacteria | 8556 |
| 120 | Ga0264413_128195 | 3300024493 | Bacteria | 5210 |
| 121 | Ga0466696_117734 | 3300042596 | Bacteria | 5907 |
| 122 | Ga0466735_127293 | 3300042624 | Bacteria | 1929 |
| 123 | Ga0466703_041270 | 3300042636 | Bacteria | 17976 |
| 124 | Ga0466703_065056 | 3300042636 | Bacteria | 39614 |
| 125 | Ga0466700_156442 | 3300042600 | Bacteria | 1297 |
| 126 | Ga0466713_045116 | 3300042602 | Bacteria | 6062 |
| 127 | Ga0466716_045118 | 3300042605 | Bacteria | 31234 |
| 128 | Ga0466716_051202 | 3300042605 | Bacteria | 6510 |
| 129 | Ga0466716_346833 | 3300042605 | Bacteria | 5568 |
| 130 | Ga0466705_023372 | 3300042612 | Bacteria | 15735 |
| 131 | Ga0466705_047752 | 3300042612 | Bacteria | 12300 |
| 132 | Ga0466705_152860 | 3300042612 | Bacteria | 2705 |
| 133 | Ga0466705_405348 | 3300042612 | Bacteria | 3537 |
| 134 | Ga0466712_228356 | 3300042614 | Bacteria | 2461 |
| 135 | Ga0466715_055859 | 3300042616 | Bacteria | 18639 |
| 136 | Ga0466715_173704 | 3300042616 | Bacteria | 8097 |
| 137 | Ga0466691_152247 | 3300042593 | Bacteria | 2224 |
| 138 | Ga0466694_050259 | 3300042594 | Bacteria | 2075 |
| 139 | Ga0466709_216584 | 3300042648 | Bacteria | 26302 |
| 140 | Ga0466708_236919 | 3300042652 | Bacteria | 12140 |
| 141 | Ga0466727_148700 | 3300042655 | Bacteria | 10958 |
| 142 | Ga0466727_321934 | 3300042655 | Bacteria | 1526 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.