Protein Family IF09088

Metagenome Metatranscriptome Isolate
244 Members
105 Samples
186 Scaffolds
348.41 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_020545|Ga0466703_020545_3831_4928
Length
365 aa
Sequence
MAPATPDRKPDIKGGATLAYRVVHYINQFFAGIGGEEKADIAPEIREGAIGPGAALQGALGADAQVVATVVCGDSYFASNMDKASADIIEMIKKYEPDAFVAGPAFNAGRYGTACGGMCEAVSKQLGIPVVSGMYPENPGVELYKKSFHIVETPNSAVGMRKAIPVMVKLLLKLLKGEAVGTPAEEGYIERGIRKNKFYDKLAAERCVEMFVAKMKGEPFETEYKMPVFDRVDPQPAVKDMKDAVIALVTSGGICPKGNPDHIEASSASKYGEYDITGVMDLTADKYCTAHGGYDATYADRNADVVLPVDVLRDMEKEGVFKKLHNKFYATVGNGTAVASAKRFGAEIADKLVADGVTAVILTST

📊 Sample Types

Isolate 23.8%
Metagenome 75.0%
MAG 0.0%
Metatranscriptome 1.2%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 48.0%
Termitidae 24.5%
Kalotermitidae 10.8%
Tenebrionidae 3.9%
Stratiomyidae 2.0%
Rhinotermitidae 2.0%
Scarabaeidae 2.0%
Termopsidae 2.0%
Rhopalidae 1.0%
Hydrophilidae 1.0%
Hodotermitidae 1.0%
Dytiscidae 1.0%
Majidae 1.0%

🌳 Taxonomy

Archaea 0
Bacteria 239
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820451402 Unclassified Firmicutes Lab288P3bin174 Isolate Unclassified
2 2820499546 Unclassified Firmicutes Lab288P1bin54 Isolate Unclassified
3 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
4 2758568796 Unclassified Deltaproteobacteria Th196P3_bin21 Isolate Unclassified
5 2824588292 Yokenella regensburgei WCD67 Isolate Rhopalidae
6 2861449170 Desulfovibrio intestinalis DSM 11275 Isolate Unclassified
7 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
8 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
9 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
10 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
11 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
12 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
13 2634166424 Clostridium sp. L74 Isolate Scarabaeidae
14 2820422691 Unclassified Firmicutes Lab288P3bin58 Isolate Unclassified
15 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
16 2820481688 Unclassified Firmicutes Lab288P1bin76 Isolate Unclassified
17 2820537337 Unclassified Firmicutes Lab288P1bin137 Isolate Unclassified
18 2820669764 Unclassified Firmicutes Co191P3bin30 Isolate Unclassified
19 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
20 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
21 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
22 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
27 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
28 2820314258 Unclassified Firmicutes Nt197P4bin16 Isolate Unclassified
29 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
30 2820459456 Unclassified Firmicutes Lab288P3bin148 Isolate Unclassified
31 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
32 2820681712 Unclassified Firmicutes Co191P1bin84 Isolate Unclassified
33 2590828839 Clostridium sp. 1 Isolate Termitidae
34 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
35 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
36 2820004052 Unclassified Synergistetes Nt197P3bin25 Isolate Unclassified
37 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
38 2820709481 Unclassified Firmicutes Co191P1bin30 Isolate Unclassified
39 2858407585 Photobacterium swingsii DSM 24669 Isolate Unclassified
40 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
41 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
42 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
43 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
44 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
45 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
46 8048928574 Photobacterium swingsii CECT 7576 Isolate Unclassified
47 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
48 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
49 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
50 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
51 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
52 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
53 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
54 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
55 2820324456 Unclassified Firmicutes Nt197P3bin80 Isolate Unclassified
56 2820497731 Unclassified Firmicutes Lab288P1bin55 Isolate Unclassified
57 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
58 2820724199 Unclassified Cloacimonetes Th196P3bin22 Isolate Unclassified
59 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
60 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
61 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
62 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
63 3300021239 Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA Metatranscriptome
64 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
65 2588253791 Yokenella regensburgei F. Haas DC-1, ATCC 49455 Isolate Unclassified
66 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
67 2820323050 Unclassified Firmicutes Nt197P3bin84 Isolate Unclassified
68 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
69 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
70 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
71 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
72 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
73 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
74 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
75 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
76 2820001644 Unclassified Synergistetes Th196P3bin106 Isolate Unclassified
77 2820431532 Unclassified Firmicutes Lab288P3bin230 Isolate Unclassified
78 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
79 2820707375 Unclassified Firmicutes Co191P1bin31 Isolate Unclassified
80 2873584433 Vagococcus coleopterorum HDW17A Isolate Dytiscidae
81 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
82 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
83 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
84 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
85 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
86 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
87 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
88 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
89 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
90 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
91 3300021227 Termite gut microbial communities from nest from French Guiana - 18-5 mRNA SA Metatranscriptome Termitidae
92 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
93 2820005795 Unclassified Synergistetes Nt197P3bin106 Isolate Unclassified
94 2820025825 Unclassified Spirochaetes Lab288P1bin8 Isolate Unclassified
95 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
96 2820637417 Unclassified Firmicutes Emb289P1bin108 Isolate Unclassified
97 2873884416 Photobacterium sanguinicancri Mj110 CAIM 1827 Isolate Majidae
98 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
99 8048923410 Photobacterium sanguinicancri CECT 7579 Isolate Unclassified
100 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
101 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
102 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
103 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
104 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
105 3300022232 Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA Metatranscriptome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_278804 3300042656 Bacteria 10504
2 Ga0123355_10001355 3300009826 Bacteria 34038
3 Ga0123355_10017491 3300009826 Bacteria 11335
4 Ga0123355_10034009 3300009826 Bacteria 8279
5 Ga0123356_10013811 3300010049 Bacteria 7777
6 Ga0123356_10015129 3300010049 Bacteria 7399
7 Ga0123356_10018634 3300010049 Bacteria 6587
8 Ga0123356_10040480 3300010049 Bacteria 4342
9 Ga0123356_10258975 3300010049 Bacteria 1822
10 Ga0123356_10610486 3300010049 Bacteria 1256
11 Ga0123353_10113549 3300010167 Bacteria 4361
12 Ga0123353_10300577 3300010167 Bacteria 2450
13 Ga0123353_10409031 3300010167 Bacteria 2016
14 Ga0123354_10098179 3300010882 Bacteria 3985
15 Ga0123354_10297119 3300010882 Bacteria 1535
16 Ga0466692_082084 3300042591 Bacteria 3099
17 Ga0466706_019772 3300042599 Bacteria 18347
18 Ga0466700_209738 3300042600 Bacteria 1789
19 Ga0466717_093391 3300042604 Bacteria 1532
20 JGI24695J34938_10009611 3300002450 Bacteria 5364
21 Ga0466711_092631 3300042615 Bacteria 17105
22 Ga0466723_355459 3300042618 Bacteria 5436
23 Ga0562379_0156 3300056790 Bacteria 206058
24 Ga0562377_0139 3300056842 Bacteria 209225
25 Ga0123355_10002238 3300009826 Bacteria 27304
26 Ga0123355_10030027 3300009826 Bacteria 8808
27 Ga0123355_10039406 3300009826 Bacteria 7687
28 Ga0123355_10128099 3300009826 Bacteria 3917
29 Ga0123356_10000033 3300010049 Bacteria 152581
30 Ga0123356_10429884 3300010049 Bacteria 1464
31 Ga0123356_10496114 3300010049 Bacteria 1376
32 Ga0123356_10611223 3300010049 Bacteria 1255
33 Ga0123353_10000246 3300010167 Bacteria 67982
34 Ga0123353_10016003 3300010167 Bacteria 10939
35 Ga0123353_10081832 3300010167 Bacteria 5193
36 Ga0123353_10140605 3300010167 Bacteria 3867
37 Ga0123353_10314190 3300010167 Bacteria 2382
38 Ga0123353_10483041 3300010167 Bacteria 1812
39 Ga0123353_10566083 3300010167 Bacteria 1635
40 Ga0123353_10611955 3300010167 Bacteria 1554
41 Ga0466695_338677 3300042595 Bacteria 2864
42 Ga0466707_409312 3300042601 Bacteria 4136
43 Ga0466713_113932 3300042602 Bacteria 26529
44 Ga0466721_120311 3300042608 Bacteria 1375
45 Ga0466703_110336 3300042636 Bacteria 21072
46 Ga0466704_015252 3300042643 Bacteria 3939
47 Ga0466704_082235 3300042643 Bacteria 7917
48 JGI24695J34938_10000462 3300002450 Bacteria 39529
49 Ga0466728_441417 3300042620 Bacteria 2434
50 Ga0562374_0016 3300057007 Bacteria 1205025
51 Ga0123355_10000321 3300009826 Bacteria 61754
52 Ga0123355_10002664 3300009826 Bacteria 25343
53 Ga0123356_10047966 3300010049 Bacteria 3974
54 Ga0123356_10267317 3300010049 Bacteria 1798
55 Ga0123356_10518830 3300010049 Bacteria 1349
56 Ga0123353_10036042 3300010167 Bacteria 7745
57 Ga0123353_10142897 3300010167 Bacteria 3832
58 Ga0123353_10190035 3300010167 Bacteria 3242
59 Ga0123353_10193181 3300010167 Bacteria 3211
60 Ga0123353_10289480 3300010167 Bacteria 2509
61 Ga0123354_10044985 3300010882 Bacteria 6762
62 Ga0264413_147828 3300024493 Bacteria 7857
63 Ga0415639_075031 3300038395 Bacteria 1853
64 Ga0466695_316042 3300042595 Bacteria 1824
65 Ga0466697_030599 3300042611 Bacteria 3665
66 Ga0466730_015692 3300042625 Bacteria 4747
67 Ga0466703_020545 3300042636 Bacteria 13780
68 Ga0466725_058551 3300042654 Bacteria 3173
69 JGI24695J34938_10001712 3300002450 Bacteria 18141
70 JGI24695J34938_10008608 3300002450 Bacteria 5799
71 JGI24702J35022_10035923 3300002462 Bacteria 2649
72 JGI24705J35276_12237270 3300002504 Bacteria 10477
73 Ga0068302_10229900 3300005071 Unclassified 6646
74 Ga0466715_303024 3300042616 Bacteria 9851
75 Ga0466733_182659 3300042659 Bacteria 183103
76 Ga0123356_10000226 3300010049 Bacteria 65646
77 Ga0123356_10002891 3300010049 Bacteria 18192
78 Ga0123356_10266192 3300010049 Bacteria 1801
79 Ga0123356_10454407 3300010049 Bacteria 1430
80 Ga0123353_10004211 3300010167 Bacteria 18469
81 Ga0123353_10197033 3300010167 Bacteria 3174
82 Ga0123353_10525704 3300010167 Bacteria 1715
83 Ga0123353_10615031 3300010167 Bacteria 1548
84 Ga0123353_10896973 3300010167 Bacteria 1208
85 Ga0415639_023011 3300038395 Bacteria 7396
86 Ga0466713_117531 3300042602 Bacteria 8658
87 Ga0466717_185858 3300042604 Bacteria 1784
88 Ga0466704_173845 3300042643 Bacteria 3401
89 Ga0466708_233908 3300042652 Bacteria 3443
90 Ga0466708_296344 3300042652 Bacteria 42210
91 JGI24698J34947_10030088 3300002449 Bacteria 2866
92 Ga0072941_1085874 3300005201 Bacteria 3304
93 Ga0466718_096774 3300042617 Bacteria 2715
94 Ga0123355_10007346 3300009826 Bacteria 16501
95 Ga0123355_10047071 3300009826 Bacteria 7013
96 Ga0123355_10172941 3300009826 Bacteria 3223
97 Ga0123355_10393342 3300009826 Bacteria 1795
98 Ga0123356_10171089 3300010049 Bacteria 2183
99 Ga0123356_10662444 3300010049 Bacteria 1211
100 Ga0123353_10235023 3300010167 Bacteria 2854
101 Ga0123353_10537671 3300010167 Bacteria 1690
102 Ga0123354_10135771 3300010882 Bacteria 3077
103 Ga0233288_1002036 3300022232 Bacteria 1863
104 Ga0415639_011622 3300038395 Bacteria 14726
105 Ga0415639_019491 3300038395 Bacteria 6073
106 Ga0466691_040768 3300042593 Bacteria 5818
107 Ga0466707_169398 3300042601 Bacteria 3990
108 Ga0466716_062152 3300042605 Bacteria 2232
109 Ga0466721_024061 3300042608 Bacteria 18917
110 Ga0466722_014565 3300042609 Bacteria 2410
111 Ga0466724_39856 3300042649 Bacteria 27534
112 JGI24698J34947_10125524 3300002449 Bacteria 1106
113 Ga0466718_021997 3300042617 Bacteria 2870
114 Ga0466726_035595 3300042619 Bacteria 3001
115 Ga0466705_042707 3300042612 Bacteria 3302
116 Ga0123355_10000594 3300009826 Bacteria 48837
117 Ga0123355_10001526 3300009826 Bacteria 32316
118 Ga0123355_10003385 3300009826 Bacteria 22828
119 Ga0123355_10287008 3300009826 Bacteria 2263
120 Ga0123356_10081052 3300010049 Bacteria 3069
121 Ga0123356_10097754 3300010049 Bacteria 2810
122 Ga0123353_10121925 3300010167 Bacteria 4191
123 Ga0415639_101942 3300038395 Bacteria 1379
124 Ga0466706_036649 3300042599 Bacteria 1214
125 Ga0466706_179366 3300042599 Bacteria 2693
126 Ga0466717_254636 3300042604 Bacteria 1431
127 Ga0466716_463608 3300042605 Bacteria 1636
128 Ga0466730_058005 3300042625 Bacteria 15510
129 Ga0466704_486561 3300042643 Bacteria 8850
130 Ga0466708_303836 3300042652 Bacteria 6336
131 Ga0466725_075225 3300042654 Bacteria 8552
132 Ga0466725_465775 3300042654 Bacteria 1950
133 JGI24698J34947_10014144 3300002449 Bacteria 4347
134 Ga0466711_052729 3300042615 Bacteria 8823
135 Ga0466711_223500 3300042615 Bacteria 2572
136 Ga0562376_0438 3300056857 Bacteria 78254
137 Ga0123355_10002190 3300009826 Bacteria 27570
138 Ga0123355_10087494 3300009826 Bacteria 4951
139 Ga0123355_10194029 3300009826 Bacteria 2983
140 Ga0123356_10000604 3300010049 Bacteria 39698
141 Ga0123356_10078799 3300010049 Bacteria 3111
142 Ga0123356_10156837 3300010049 Unclassified 2268
143 Ga0123356_10679026 3300010049 Bacteria 1198
144 Ga0123353_10460766 3300010167 Bacteria 1868
145 Ga0123353_10488282 3300010167 Bacteria 1799
146 Ga0123353_10687321 3300010167 Bacteria 1439
147 Ga0223688_1022359 3300021227 Bacteria 1373
148 Ga0223677_1003484 3300021239 Bacteria 1926
149 Ga0415639_010121 3300038395 Bacteria 32586
150 Ga0466695_224236 3300042595 Bacteria 1651
151 Ga0466700_007655 3300042600 Bacteria 2496
152 Ga0466713_013935 3300042602 Bacteria 20840
153 Ga0466721_030930 3300042608 Bacteria 10094
154 Ga0466698_160357 3300042610 Bacteria 2129
155 Ga0466724_18762 3300042649 Bacteria 6551
156 Ga0466705_499825 3300042612 Unclassified 6019
157 Ga0466711_418877 3300042615 Bacteria 4669
158 Ga0466711_435802 3300042615 Bacteria 15198
159 Ga0466726_320739 3300042619 Bacteria 1859
160 Ga0466705_213543 3300042612 Bacteria 3949
161 Ga0466705_301455 3300042612 Bacteria 23726
162 Ga0123355_10004100 3300009826 Bacteria 21124
163 Ga0123355_10005257 3300009826 Bacteria 18906
164 Ga0123355_10017343 3300009826 Bacteria 11377
165 Ga0123355_10028686 3300009826 Bacteria 9000
166 Ga0123355_10083818 3300009826 Bacteria 5080
167 Ga0123356_10009784 3300010049 Bacteria 9450
168 Ga0123356_10017775 3300010049 Bacteria 6756
169 Ga0123356_10022362 3300010049 Bacteria 5971
170 Ga0123356_10037243 3300010049 Bacteria 4539
171 Ga0123353_10003265 3300010167 Bacteria 20469
172 Ga0123353_10010227 3300010167 Bacteria 13056
173 Ga0123353_10012912 3300010167 Bacteria 11922
174 Ga0123353_10017084 3300010167 Bacteria 10641
175 Ga0123353_10240350 3300010167 Bacteria 2814
176 Ga0123353_10315297 3300010167 Bacteria 2377
177 Ga0123353_10524660 3300010167 Bacteria 1717
178 Ga0123353_10715669 3300010167 Bacteria 1402
179 Ga0415639_111612 3300038395 Bacteria 2038
180 Ga0415639_174271 3300038395 Unclassified 1641
181 Ga0466696_377997 3300042596 Bacteria 1466
182 Ga0466725_154695 3300042654 Bacteria 19274
183 JGI24695J34938_10023034 3300002450 Unclassified 3010
184 JGI24703J35330_11606521 3300002501 Bacteria 1395
185 JGI24703J35330_11748283 3300002501 Bacteria 13053
186 Ga0466728_230236 3300042620 Bacteria 2215

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07355 GRDB Glycine/sarcosine/betaine reductase selenoprotein B (GRDB) 20 365 1

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF07355 GO:0050485 oxidoreductase activity, acting on X-H and Y-H to form an X-Y bond, with a disulfide as acceptor MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.