Protein Family IF09049
Metagenome
Isolate
171
Members
54
Samples
160
Scaffolds
225.72
Avg Length
Representative Sequence
- ID
- 3300042635|Ga0466702_140506|Ga0466702_140506_355_999
- Length
- 214 aa
- Sequence
- MGALEVHALKGVSLDIAEGEFVSIAGPSGSGKTTLMNIIGLIDSFNSGSLTVNGLEIKNQSRRELARLRRELLGFVFQSFNLLPVLNVFENIELPLIISKKGNKAQRRERVNYLLEEVGLADRSRHVPAELSGGQQQRVAIARALVTNPGIVIADEPTANLDSGTGEKVLDLMKNINKTEKTTFIFSTHDPGIWKMADHIIFLQDGLIKSEQRQ
Sample Types
Isolate
6.4%
Metagenome
93.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.1%
Unclassified
23.5%
Kalotermitidae
23.5%
Rhinotermitidae
3.9%
Termopsidae
3.9%
Taxonomy
Archaea
1
Bacteria
158
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 2 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 3 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 4 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 5 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 6 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 7 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 8 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 9 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 10 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 11 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 12 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 13 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 14 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 15 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 16 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 17 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 18 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 21 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 22 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 25 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 26 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 27 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 28 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 29 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 30 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 31 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 32 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 33 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 34 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 35 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 36 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 37 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 38 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 39 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 40 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 41 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 42 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 43 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 44 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 45 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 46 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 47 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 48 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 49 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 50 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 51 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 52 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 53 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 54 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_014040 | 3300042656 | Bacteria | 45614 |
| 2 | Ga0466733_059923 | 3300042659 | Bacteria | 4093 |
| 3 | Ga0466733_155910 | 3300042659 | Bacteria | 17332 |
| 4 | Ga0466694_169185 | 3300042594 | Bacteria | 8767 |
| 5 | Ga0466696_020352 | 3300042596 | Bacteria | 5138 |
| 6 | Ga0466715_026439 | 3300042616 | Bacteria | 28376 |
| 7 | Ga0466718_043842 | 3300042617 | Bacteria | 9656 |
| 8 | Ga0466718_058448 | 3300042617 | Bacteria | 26775 |
| 9 | Ga0466718_154969 | 3300042617 | Bacteria | 4084 |
| 10 | Ga0466728_056346 | 3300042620 | Bacteria | 16206 |
| 11 | Ga0466709_232315 | 3300042648 | Unclassified | 17650 |
| 12 | Ga0466709_253615 | 3300042648 | Bacteria | 24952 |
| 13 | Ga0466727_303304 | 3300042655 | Bacteria | 1566 |
| 14 | Ga0123357_10138366 | 3300009784 | Bacteria | 3002 |
| 15 | Ga0123356_10007426 | 3300010049 | Bacteria | 10935 |
| 16 | Ga0123356_10302615 | 3300010049 | Bacteria | 1705 |
| 17 | Ga0466700_329484 | 3300042600 | Bacteria | 1084 |
| 18 | Ga0466698_062596 | 3300042610 | Bacteria | 1370 |
| 19 | AustNasuHG_c1001722 | 3300000089 | Bacteria | 7904 |
| 20 | AustNasuHG_c1002941 | 3300000089 | Bacteria | 6134 |
| 21 | JGI24695J34938_10000444 | 3300002450 | Bacteria | 40024 |
| 22 | Ga0072941_1023156 | 3300005201 | Bacteria | 7267 |
| 23 | Ga0072941_1038484 | 3300005201 | Bacteria | 5484 |
| 24 | Ga0074263_111822 | 3300005485 | Unclassified | 2169 |
| 25 | Ga0264413_104284 | 3300024493 | Bacteria | 9049 |
| 26 | Ga0264413_108093 | 3300024493 | Bacteria | 14472 |
| 27 | Ga0466712_306462 | 3300042614 | Bacteria | 8550 |
| 28 | Ga0466718_157471 | 3300042617 | Bacteria | 29584 |
| 29 | Ga0466702_140506 | 3300042635 | Bacteria | 1171 |
| 30 | Ga0466703_114433 | 3300042636 | Bacteria | 25250 |
| 31 | Ga0466727_288465 | 3300042655 | Bacteria | 1651 |
| 32 | Ga0123356_10013089 | 3300010049 | Bacteria | 8024 |
| 33 | Ga0466700_152999 | 3300042600 | Unclassified | 2755 |
| 34 | Ga0466707_266124 | 3300042601 | Bacteria | 1180 |
| 35 | Ga0466719_103638 | 3300042606 | Bacteria | 1928 |
| 36 | Ga0466720_174880 | 3300042607 | Bacteria | 19806 |
| 37 | AustNasuHG_c1000958 | 3300000089 | Bacteria | 10425 |
| 38 | AustNasuHG_c1010886 | 3300000089 | Unclassified | 3159 |
| 39 | JGI24698J34947_10089828 | 3300002449 | Bacteria | 1413 |
| 40 | JGI24695J34938_10003453 | 3300002450 | Bacteria | 11036 |
| 41 | Ga0072940_1004615 | 3300005200 | Bacteria | 8291 |
| 42 | Ga0074263_102795 | 3300005485 | Unclassified | 1233 |
| 43 | Ga0264413_100365 | 3300024493 | Bacteria | 60695 |
| 44 | Ga0466694_017836 | 3300042594 | Bacteria | 66785 |
| 45 | Ga0466705_419735 | 3300042612 | Bacteria | 1022 |
| 46 | Ga0466712_069703 | 3300042614 | Bacteria | 18452 |
| 47 | Ga0466712_090242 | 3300042614 | Bacteria | 11818 |
| 48 | Ga0466712_096948 | 3300042614 | Bacteria | 13734 |
| 49 | Ga0466711_183080 | 3300042615 | Bacteria | 24817 |
| 50 | Ga0466711_366411 | 3300042615 | Bacteria | 1970 |
| 51 | Ga0466718_031358 | 3300042617 | Bacteria | 2019 |
| 52 | Ga0466718_083674 | 3300042617 | Bacteria | 23117 |
| 53 | Ga0466718_103920 | 3300042617 | Bacteria | 11849 |
| 54 | Ga0466726_120444 | 3300042619 | Bacteria | 4554 |
| 55 | Ga0466703_017017 | 3300042636 | Bacteria | 1135 |
| 56 | Ga0123357_10252207 | 3300009784 | Archaea | 1885 |
| 57 | Ga0123355_10001012 | 3300009826 | Bacteria | 38990 |
| 58 | Ga0123356_11633009 | 3300010049 | Bacteria | 798 |
| 59 | Ga0466700_099604 | 3300042600 | Bacteria | 1751 |
| 60 | Ga0466720_178452 | 3300042607 | Bacteria | 61615 |
| 61 | Ga0466720_183123 | 3300042607 | Bacteria | 5841 |
| 62 | AustNasuHG_c1011765 | 3300000089 | Bacteria | 3030 |
| 63 | JGI24698J34947_10009196 | 3300002449 | Bacteria | 5422 |
| 64 | JGI24698J34947_10040882 | 3300002449 | Bacteria | 2391 |
| 65 | Ga0072941_1045720 | 3300005201 | Bacteria | 1724 |
| 66 | Ga0072941_1101721 | 3300005201 | Bacteria | 5376 |
| 67 | Ga0072941_1181108 | 3300005201 | Unclassified | 1728 |
| 68 | Ga0264413_114720 | 3300024493 | Bacteria | 4172 |
| 69 | Ga0264413_120920 | 3300024493 | Bacteria | 4508 |
| 70 | Ga0415639_087266 | 3300038395 | Bacteria | 4021 |
| 71 | Ga0466711_377011 | 3300042615 | Bacteria | 37393 |
| 72 | Ga0466715_410140 | 3300042616 | Bacteria | 5091 |
| 73 | Ga0466726_105473 | 3300042619 | Bacteria | 10066 |
| 74 | Ga0466703_054784 | 3300042636 | Bacteria | 3144 |
| 75 | Ga0123356_10000059 | 3300010049 | Bacteria | 117133 |
| 76 | Ga0123353_10457262 | 3300010167 | Bacteria | 1877 |
| 77 | Ga0466720_065410 | 3300042607 | Bacteria | 38105 |
| 78 | Ga0466720_091499 | 3300042607 | Unclassified | 3118 |
| 79 | Ga0466720_108024 | 3300042607 | Bacteria | 60869 |
| 80 | AustNasuHG_c1002524 | 3300000089 | Bacteria | 6628 |
| 81 | AustNasuHG_c1022035 | 3300000089 | Bacteria | 2053 |
| 82 | JGI24695J34938_10000188 | 3300002450 | Bacteria | 57980 |
| 83 | JGI24695J34938_10002895 | 3300002450 | Bacteria | 12485 |
| 84 | JGI24695J34938_10066195 | 3300002450 | Bacteria | 1523 |
| 85 | Ga0264413_105979 | 3300024493 | Bacteria | 7443 |
| 86 | Ga0264413_124100 | 3300024493 | Bacteria | 13335 |
| 87 | Ga0466694_087247 | 3300042594 | Bacteria | 2903 |
| 88 | Ga0466699_355839 | 3300042597 | Bacteria | 2200 |
| 89 | Ga0466712_029124 | 3300042614 | Bacteria | 12816 |
| 90 | Ga0466712_098031 | 3300042614 | Bacteria | 43056 |
| 91 | Ga0466712_129113 | 3300042614 | Bacteria | 3382 |
| 92 | Ga0466712_160538 | 3300042614 | Bacteria | 10330 |
| 93 | Ga0466731_409406 | 3300042622 | Bacteria | 1379 |
| 94 | Ga0466704_031012 | 3300042643 | Bacteria | 5617 |
| 95 | Ga0466704_041045 | 3300042643 | Bacteria | 23821 |
| 96 | Ga0466709_280480 | 3300042648 | Bacteria | 5472 |
| 97 | Ga0466719_329317 | 3300042606 | Bacteria | 1215 |
| 98 | Ga0466721_062035 | 3300042608 | Bacteria | 1290 |
| 99 | Ga0466722_160603 | 3300042609 | Bacteria | 2051 |
| 100 | JGI24698J34947_10003004 | 3300002449 | Bacteria | 9142 |
| 101 | JGI24695J34938_10001748 | 3300002450 | Bacteria | 17965 |
| 102 | JGI24695J34938_10013113 | 3300002450 | Bacteria | 4364 |
| 103 | Ga0072940_1036840 | 3300005200 | Unclassified | 1714 |
| 104 | Ga0466732_216647 | 3300042656 | Bacteria | 8635 |
| 105 | Ga0264413_104325 | 3300024493 | Bacteria | 24047 |
| 106 | Ga0466690_145171 | 3300042590 | Bacteria | 4250 |
| 107 | Ga0466694_214517 | 3300042594 | Bacteria | 32563 |
| 108 | Ga0466695_221990 | 3300042595 | Bacteria | 77793 |
| 109 | Ga0466696_101064 | 3300042596 | Bacteria | 10245 |
| 110 | Ga0466696_179736 | 3300042596 | Bacteria | 2330 |
| 111 | Ga0466715_537660 | 3300042616 | Bacteria | 6730 |
| 112 | Ga0466718_002524 | 3300042617 | Bacteria | 42896 |
| 113 | Ga0466718_039632 | 3300042617 | Bacteria | 5050 |
| 114 | Ga0466718_041811 | 3300042617 | Bacteria | 20555 |
| 115 | Ga0466726_488923 | 3300042619 | Bacteria | 2609 |
| 116 | Ga0466702_370804 | 3300042635 | Bacteria | 1737 |
| 117 | Ga0466703_002721 | 3300042636 | Bacteria | 7698 |
| 118 | Ga0466703_229778 | 3300042636 | Bacteria | 8159 |
| 119 | Ga0466703_398809 | 3300042636 | Bacteria | 2916 |
| 120 | Ga0123356_10089164 | 3300010049 | Bacteria | 2934 |
| 121 | Ga0123356_10172267 | 3300010049 | Bacteria | 2176 |
| 122 | Ga0123353_10672912 | 3300010167 | Bacteria | 1460 |
| 123 | Ga0466700_183341 | 3300042600 | Bacteria | 1968 |
| 124 | Ga0466716_511098 | 3300042605 | Bacteria | 1963 |
| 125 | Ga0466720_042936 | 3300042607 | Bacteria | 30548 |
| 126 | AustNasuHG_c1032031 | 3300000089 | Bacteria | 1468 |
| 127 | JGI24698J34947_10000132 | 3300002449 | Bacteria | 27417 |
| 128 | JGI24695J34938_10001794 | 3300002450 | Bacteria | 17657 |
| 129 | Ga0264413_139567 | 3300024493 | Bacteria | 4832 |
| 130 | Ga0466696_296208 | 3300042596 | Bacteria | 6992 |
| 131 | Ga0466712_139760 | 3300042614 | Bacteria | 32143 |
| 132 | Ga0466718_042280 | 3300042617 | Bacteria | 2411 |
| 133 | Ga0466718_075255 | 3300042617 | Bacteria | 21483 |
| 134 | Ga0466726_361084 | 3300042619 | Bacteria | 2806 |
| 135 | Ga0466704_112416 | 3300042643 | Bacteria | 17765 |
| 136 | Ga0466704_520064 | 3300042643 | Bacteria | 11148 |
| 137 | Ga0466708_061086 | 3300042652 | Unclassified | 10356 |
| 138 | Ga0466708_075233 | 3300042652 | Bacteria | 1520 |
| 139 | Ga0466708_414030 | 3300042652 | Bacteria | 7200 |
| 140 | Ga0466719_008977 | 3300042606 | Bacteria | 4456 |
| 141 | AustNasuHG_c1001681 | 3300000089 | Bacteria | 7984 |
| 142 | Ga0072940_1145631 | 3300005200 | Unclassified | 4862 |
| 143 | Ga0072941_1021659 | 3300005201 | Bacteria | 6805 |
| 144 | Ga0074263_111823 | 3300005485 | Unclassified | 3131 |
| 145 | Ga0264413_100367 | 3300024493 | Bacteria | 29796 |
| 146 | Ga0466694_023775 | 3300042594 | Bacteria | 39540 |
| 147 | Ga0466699_169385 | 3300042597 | Bacteria | 38335 |
| 148 | Ga0466718_036118 | 3300042617 | Bacteria | 4945 |
| 149 | Ga0466726_326387 | 3300042619 | Bacteria | 1030 |
| 150 | Ga0466729_151543 | 3300042621 | Bacteria | 1764 |
| 151 | Ga0466703_401770 | 3300042636 | Bacteria | 10081 |
| 152 | Ga0123357_10145411 | 3300009784 | Bacteria | 2898 |
| 153 | Ga0466722_011893 | 3300042609 | Bacteria | 1507 |
| 154 | FAAS_10006127 | 3300001880 | Bacteria | 937 |
| 155 | JGI24698J34947_10004039 | 3300002449 | Bacteria | 7975 |
| 156 | JGI24698J34947_10004366 | 3300002449 | Bacteria | 7693 |
| 157 | JGI24695J34938_10000098 | 3300002450 | Bacteria | 76790 |
| 158 | JGI24695J34938_10003603 | 3300002450 | Bacteria | 10639 |
| 159 | JGI24695J34938_10011660 | 3300002450 | Unclassified | 4720 |
| 160 | Ga0072941_1009244 | 3300005201 | Bacteria | 10446 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.