Protein Family IF09040

Metagenome Isolate
125 Members
37 Samples
114 Scaffolds
219.42 Avg Length

🧬 Representative Sequence

ID
3300042635|Ga0466702_074175|Ga0466702_074175_507_1247
Length
246 aa
Sequence
MFFPPASRLPKGLYSIKSCYYNQSMKLTMPEEIRDAIAKEGIIAVLEIESEKNAVPAAKALLEGGITVIEVLLRTPAAVPSISLIASEVPQMFISIGTIIESGQAAMVKKDKGVRYGVSPGLNPEIIKEAIAAGLPFAPGIATASELEQAISLGCRVVKFFPAEGLGGLSYLKSLNAPYNHLGIKYIPLGGVSVNNLADYAKFGPVLAVGGSWIANKELINAQDWKEITKRAKEAKDIWHSIRIPS

📊 Sample Types

Isolate 8.8%
Metagenome 91.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 62.9%
Unclassified 28.6%
Kalotermitidae 5.7%
Blaberidae 2.9%

🌳 Taxonomy

Archaea 1
Bacteria 92
Eukaryota 0
Viruses 0
Unclassified 32

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
2 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
7 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
8 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
9 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Termitidae
10 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
11 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
12 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
13 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
14 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
15 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
16 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
17 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
18 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
19 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
20 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
21 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
22 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
23 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
24 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
25 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
26 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
27 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
28 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
29 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
30 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
31 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
32 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
33 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
34 2772190975 Treponema sp. RmG30 Isolate Blaberidae
35 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
36 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
37 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 AustNasuHG_c1000357 3300000089 Bacteria 15851
2 JGI24698J34947_10036713 3300002449 Unclassified 2550
3 JGI24698J34947_10039697 3300002449 Unclassified 2435
4 JGI24695J34938_10000530 3300002450 Bacteria 36998
5 JGI24695J34938_10001954 3300002450 Bacteria 16541
6 Ga0072941_1081254 3300005201 Unclassified 1583
7 Ga0123356_10013089 3300010049 Bacteria 8024
8 Ga0466698_018193 3300042610 Bacteria 11248
9 Ga0466694_030726 3300042594 Bacteria 34162
10 Ga0466694_154976 3300042594 Bacteria 1570
11 Ga0466712_054681 3300042614 Bacteria 13941
12 Ga0466712_114908 3300042614 Bacteria 1652
13 Ga0466718_052540 3300042617 Bacteria 1943
14 Ga0466718_065215 3300042617 Bacteria 2999
15 Ga0466718_082861 3300042617 Bacteria 1521
16 Ga0466702_043303 3300042635 Unclassified 2231
17 JGI24695J34938_10000266 3300002450 Bacteria 50844
18 Ga0072941_1029452 3300005201 Bacteria 2757
19 Ga0074263_112205 3300005485 Unclassified 1589
20 Ga0123356_10041427 3300010049 Bacteria 4291
21 Ga0466717_096949 3300042604 Unclassified 1667
22 Ga0466690_021756 3300042590 Unclassified 3926
23 Ga0466712_038716 3300042614 Bacteria 4587
24 Ga0466712_174530 3300042614 Bacteria 1769
25 Ga0466712_178160 3300042614 Unclassified 2285
26 Ga0466718_044516 3300042617 Unclassified 5009
27 Ga0466718_110369 3300042617 Unclassified 2909
28 Ga0466731_017535 3300042622 Bacteria 7008
29 JGI24698J34947_10065556 3300002449 Bacteria 1770
30 JGI24695J34938_10000048 3300002450 Bacteria 91577
31 JGI24695J34938_10000188 3300002450 Bacteria 57980
32 JGI24695J34938_10002895 3300002450 Bacteria 12485
33 Ga0072941_1004431 3300005201 Bacteria 21264
34 Ga0466720_179866 3300042607 Unclassified 7617
35 Ga0466721_371208 3300042608 Bacteria 4903
36 Ga0415639_020694 3300038395 Bacteria 1166
37 Ga0466699_184149 3300042597 Bacteria 40447
38 Ga0466699_432603 3300042597 Unclassified 1164
39 Ga0466712_027313 3300042614 Bacteria 5752
40 Ga0466712_059900 3300042614 Bacteria 16710
41 Ga0466712_164129 3300042614 Unclassified 1841
42 Ga0466702_074175 3300042635 Unclassified 1383
43 Ga0466702_313552 3300042635 Bacteria 2132
44 Nasutiter_Contig09072 2030936001 Unclassified 725
45 JGI24698J34947_10130885 3300002449 Unclassified 1072
46 JGI24695J34938_10000054 3300002450 Bacteria 90526
47 Ga0072941_1127401 3300005201 Unclassified 1469
48 Ga0123356_10089164 3300010049 Bacteria 2934
49 Ga0466720_040007 3300042607 Bacteria 3638
50 Ga0264413_116331 3300024493 Bacteria 10299
51 Ga0466699_270359 3300042597 Bacteria 2041
52 Ga0466712_035454 3300042614 Bacteria 21926
53 Ga0466718_068115 3300042617 Unclassified 3396
54 Ga0466731_421404 3300042622 Bacteria 1595
55 Ga0466730_062366 3300042625 Unclassified 1238
56 JGI24698J34947_10016007 3300002449 Bacteria 4078
57 JGI24698J34947_10025553 3300002449 Unclassified 3143
58 JGI24698J34947_10030664 3300002449 Bacteria 2835
59 JGI24698J34947_10128005 3300002449 Unclassified 1090
60 JGI24695J34938_10000064 3300002450 Bacteria 87537
61 JGI24695J34938_10067539 3300002450 Unclassified 1504
62 Ga0072941_1282976 3300005201 Bacteria 1863
63 Ga0123356_10270570 3300010049 Bacteria 1788
64 Ga0123353_10009794 3300010167 Bacteria 13276
65 Ga0466693_160454 3300042592 Bacteria 37262
66 Ga0466712_203282 3300042614 Bacteria 6440
67 JGI24698J34947_10006160 3300002449 Bacteria 6587
68 JGI24698J34947_10020751 3300002449 Bacteria 3537
69 JGI24698J34947_10049184 3300002449 Bacteria 2132
70 JGI24698J34947_10121346 3300002449 Unclassified 1134
71 JGI24695J34938_10098694 3300002450 Unclassified 1194
72 Ga0072941_1014882 3300005201 Bacteria 5969
73 Ga0123355_10110917 3300009826 Bacteria 4286
74 Ga0123356_10007426 3300010049 Bacteria 10935
75 Ga0123356_10015455 3300010049 Bacteria 7315
76 Ga0123356_10050365 3300010049 Bacteria 3876
77 Ga0466720_137311 3300042607 Bacteria 8536
78 Ga0466694_194991 3300042594 Bacteria 3937
79 Ga0466694_258191 3300042594 Bacteria 2120
80 Ga0466699_216128 3300042597 Unclassified 1154
81 Ga0466712_079923 3300042614 Unclassified 1081
82 Ga0466718_009447 3300042617 Unclassified 2593
83 Ga0466731_413704 3300042622 Bacteria 40616
84 Ga0466702_211037 3300042635 Bacteria 1055
85 Ga0466732_316863 3300042656 Bacteria 36287
86 JGI24698J34947_10003142 3300002449 Bacteria 8946
87 JGI24698J34947_10006091 3300002449 Bacteria 6619
88 JGI24698J34947_10007504 3300002449 Bacteria 5993
89 JGI24698J34947_10030984 3300002449 Bacteria 2817
90 JGI24695J34938_10003515 3300002450 Bacteria 10877
91 JGI24695J34938_10014232 3300002450 Bacteria 4135
92 Ga0123356_10001025 3300010049 Bacteria 31099
93 Ga0123356_10013872 3300010049 Bacteria 7759
94 Ga0466720_101643 3300042607 Bacteria 10478
95 Ga0264413_100809 3300024493 Unclassified 5316
96 Ga0466694_111107 3300042594 Bacteria 2303
97 Ga0466699_383265 3300042597 Archaea 1445
98 Ga0466723_129009 3300042618 Bacteria 12957
99 Ga0466731_347599 3300042622 Bacteria 3753
100 Ga0466702_453322 3300042635 Unclassified 1637
101 JGI24698J34947_10001601 3300002449 Bacteria 12030
102 JGI24698J34947_10063975 3300002449 Bacteria 1801
103 JGI24695J34938_10000098 3300002450 Bacteria 76790
104 JGI24695J34938_10001578 3300002450 Bacteria 19188
105 JGI24695J34938_10003603 3300002450 Bacteria 10639
106 Ga0072941_1013753 3300005201 Bacteria 19926
107 Ga0072941_1014881 3300005201 Bacteria 8992
108 Ga0072941_1015441 3300005201 Bacteria 7679
109 Ga0072941_1081253 3300005201 Unclassified 2759
110 Ga0074263_102352 3300005485 Bacteria 3415
111 Ga0466720_182257 3300042607 Bacteria 2600
112 Ga0466698_168543 3300042610 Unclassified 2001
113 Ga0264413_100808 3300024493 Unclassified 5256
114 Ga0466702_255603 3300042635 Bacteria 4671

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01081 Aldolase KDPG and KHG aldolase 36 230 0.96

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01081 GO:0016829 lyase activity MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.