Protein Family IF09024

Metagenome Isolate
210 Members
160 Samples
113 Scaffolds
184.74 Avg Length

🧬 Representative Sequence

ID
3300042625|Ga0466730_098463|Ga0466730_098463_475_1137
Length
220 aa
Sequence
MSCRSGTVQEQDATQPAADRRVTAAGPTQDTQEQVVIEETLLEAEEKMEKAVVVAKEDFAAIRTGRAHPAMFNKIVADYYGAPTPINQLASFSVPEPRMAVVTPFDKSALRNIEQAIRDSDLGVNPSNDGNIIRVVFPELTEERRRDYIKVAKGKGEDAKVSIRSVRRKAKDAIDKLIKDGEVGEDEGRRAEKELDDTTAKYVAQVDELLKHKEAELLEV

📊 Sample Types

Isolate 46.2%
Metagenome 53.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 31.1%
Termitidae 20.9%
Formicidae 10.1%
Kalotermitidae 6.1%
Scarabaeidae 5.4%
Armadillidiidae 4.1%
Culicidae 4.1%
Tenebrionidae 3.4%
Elmidae 2.0%
Hydrophilidae 2.0%
Cambaridae 1.4%
Rhinotermitidae 1.4%
Termopsidae 1.4%
Apidae 0.7%
Cimicidae 0.7%
Pyralidae 0.7%
Ixodidae 0.7%
Curculionidae 0.7%
Thomisidae 0.7%
Hodotermitidae 0.7%
Passalidae 0.7%
Reduviidae 0.7%
Siricidae 0.7%

🌳 Taxonomy

Archaea 0
Bacteria 197
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
2 2518645556 Nocardiopsis alba ATCC BAA-2165 Isolate Apidae
3 2547132042 Pseudonocardia sp. P2 Isolate Formicidae
4 2718217924 Pseudonocardia sp. HH130630-07 Isolate Formicidae
5 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
6 2847305884 Microbacterium protaetiae DFW100M-13 Isolate Scarabaeidae
7 2856960404 Pseudonocardia sp. Ae706_Ps2 Isolate Formicidae
8 2856973192 Pseudonocardia sp. Ae331_Ps2 Isolate Formicidae
9 2859970369 Pseudonocardia sp. Ae717_Ps2 Isolate Formicidae
10 2862784999 Streptomyces sp. M41 Isolate Unclassified
11 2864773010 Tsukamurella ocularis S00022 Isolate Elmidae
12 2909412500 Yimella sp. cx-573 Isolate Cambaridae
13 2931425734 Nocardioides sp. J2M5 Isolate
14 2931430189 Tessaracoccus palaemonis J1M15 Isolate
15 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
16 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
17 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
18 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
19 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
20 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
21 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
22 2671180625 Pseudonocardia sp. EC080619-01 Isolate Formicidae
23 2675903013 Rhodococcus triatomae DSM 44892 Isolate Unclassified
24 2820818506 Unclassified Actinobacteria Nt197P3bin3 Isolate Unclassified
25 2820845766 Unclassified Actinobacteria Lab288P3bin96 Isolate Unclassified
26 2820889385 Unclassified Actinobacteria Lab288P1bin133 Isolate Unclassified
27 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
28 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
29 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
30 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
31 646564587 Tsukamurella paurometabola 33, DSM 20162 Isolate Cimicidae
32 8062637095 Yimella sp. cx-51 Isolate Cambaridae
33 8077775691 Tsukamurella sp. PLM1 Isolate Formicidae
34 8077783556 Streptomyces sp. PLM4 Isolate Formicidae
35 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
36 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
37 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
38 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
39 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
40 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
41 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
42 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
43 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
44 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
45 2820903739 Unclassified Actinobacteria Emb289P4bin49 Isolate Unclassified
46 2841168549 Agromyces protaetiae FW100M-8 Isolate Scarabaeidae
47 2856954254 Pseudonocardia sp. Ae505_Ps2 Isolate Formicidae
48 2864918810 Tsukamurella ocularis S00175 Isolate Elmidae
49 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
50 2900368070 Nocardia aurantia RB56 Isolate Termitidae
51 2912749649 Streptomyces sp. GS7 Isolate Termitidae
52 3006461590 Streptomyces sp. RB5 Isolate Termitidae
53 3006667155 Streptomyces sp. SID9727 Isolate
54 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
55 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
56 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
57 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
58 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
59 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
60 2515154104 Streptomyces sp. KhCrAH-244 Isolate Unclassified
61 2681812870 Oerskovia enterophila DFA-19 Isolate Unclassified
62 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
63 2820422691 Unclassified Firmicutes Lab288P3bin58 Isolate Unclassified
64 2820441105 Unclassified Firmicutes Lab288P3bin202 Isolate Unclassified
65 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
66 2820914081 Unclassified Actinobacteria Emb289P3bin87 Isolate Unclassified
67 2848356102 Xylanimonas allomyrinae 2JSPR-7 Isolate Scarabaeidae
68 2862075925 Corynebacterium lactis S064 Isolate Ixodidae
69 2896955351 Streptomyces sp. GF20 Isolate Termitidae
70 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
71 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
72 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
73 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
74 647000328 Streptomyces sp. ACT-1 XylebKG-1 Isolate Curculionidae
75 649989992 Pseudonocardia sp. P1 Isolate Formicidae
76 8053361298 Streptomyces formicae 1H-GS9 Isolate Unclassified
77 8067987626 Agromyces larvae CFWR-12 Isolate Unclassified
78 8073544309 Actinomadura sp. RB99 Isolate Termitidae
79 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
80 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
81 2648501322 Streptomyces sp. SA3_actF Isolate Unclassified
82 2734481968 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
83 2820816657 Unclassified Actinobacteria Nt197P3bin38 Isolate Unclassified
84 2820901319 Unclassified Actinobacteria Emb289P4bin58 Isolate Unclassified
85 2856882415 Pseudonocardia sp. Ae406_Ps2 Isolate Formicidae
86 2859977607 Pseudonocardia sp. Ae707_Ps1 Isolate Formicidae
87 2864964650 Tsukamurella ocularis S00236 Isolate Elmidae
88 2873558832 Propioniciclava coleopterorum HDW11 Isolate Hydrophilidae
89 2873589062 Phycicoccus sp. HDW14 Isolate Hydrophilidae
90 2900354037 Nocardia macrotermitis RB20 Isolate Termitidae
91 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
92 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
93 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
94 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
95 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
96 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
97 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
98 8109397740 Rhodococcus triatomae DSM 44892 Isolate Unclassified
99 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
100 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
101 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
102 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
103 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
104 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
105 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
106 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
107 8118075156 Actinosynnema pretiosum DSM 44131 Isolate Unclassified
108 2820545146 Unclassified Firmicutes Lab288P1bin104 Isolate Unclassified
109 2820800812 Unclassified Actinobacteria Th196P4bin28 Isolate Unclassified
110 2820882373 Unclassified Actinobacteria Lab288P1bin45 Isolate Unclassified
111 2836973655 Gryllotalpicola protaetiae 2DFW10M-5 Isolate Scarabaeidae
112 2856652821 Actinomadura rubteroloni RB29 Isolate Unclassified
113 2873196663 Streptomyces capitiformicae 1H-SSA4 Isolate Formicidae
114 2908241010 Streptomyces sp. HF10 Isolate Termitidae
115 2912817845 Streptomyces griseus SID164 Isolate
116 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
117 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
118 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
119 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
120 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
121 3006468911 Streptomyces sp. RB17 Isolate Termitidae
122 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
123 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
124 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
125 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
126 2545824723 Rhodococcus rhodnii LMG 5362 Isolate Reduviidae
127 2547132081 Streptomyces sp. S4 Isolate Formicidae
128 2816332114 Microbacterium saperdae DSM 20169 Isolate Unclassified
129 2820799971 Unclassified Actinobacteria Th196P4bin46 Isolate Unclassified
130 2820823448 Unclassified Actinobacteria Nt197P3bin113 Isolate Unclassified
131 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
132 2820894511 Unclassified Actinobacteria Lab288P1bin103 Isolate Unclassified
133 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
134 2820916033 Unclassified Actinobacteria Emb289P3bin63 Isolate Unclassified
135 2918394494 Microbacterium imperiale DSM 20530 Isolate Unclassified
136 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
137 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
138 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae
139 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
140 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
141 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
142 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
143 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
144 2523533511 Streptomyces sp. Sv. ACTE SirexAA-E Isolate Siricidae
145 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
146 2818991320 Klugiella xanthotipulae DSM 18031 Isolate Unclassified
147 2820834831 Unclassified Actinobacteria Lab288P4bin79 Isolate Unclassified
148 2820840446 Unclassified Actinobacteria Lab288P4bin17 Isolate Unclassified
149 2820857933 Unclassified Actinobacteria Lab288P3bin173 Isolate Unclassified
150 2820863028 Unclassified Actinobacteria Lab288P3bin164 Isolate Unclassified
151 2861945162 Microbacterium sp. AR7-10 Isolate Culicidae
152 2883683260 Protaetiibacter larvae KACC 19322 Isolate Scarabaeidae
153 2888667245 Corynebacterium diphtheriae FRC0190 Isolate Unclassified
154 2898589227 Actinomadura macrotermitis RB68 Isolate Termitidae
155 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
156 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
157 3002678670 Agromyces sp. G127AT Isolate Unclassified
158 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
159 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
160 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0530661_054119 3300056564 Bacteria 1168
2 Ga0160468_114016 3300012819 Bacteria 737
3 Ga0160435_1005308 3300012857 Bacteria 2931
4 Ga0160436_1000008 3300012861 Bacteria 157642
5 Ga0466697_011498 3300042611 Bacteria 4603
6 Ga0123356_10009253 3300010049 Bacteria 9733
7 Ga0123354_10002262 3300010882 Bacteria 25152
8 Ga0466705_417321 3300042612 Bacteria 4864
9 Ga0466705_505895 3300042612 Bacteria 3268
10 Ga0466723_084812 3300042618 Bacteria 35121
11 AustNasuHG_c1000174 3300000089 Bacteria 20828
12 AustNasuHG_c1002927 3300000089 Bacteria 6148
13 JGI24699J35502_11132553 3300002509 Bacteria 7077
14 Ga0466734_160259 3300042623 Bacteria 1426
15 Ga0466708_146494 3300042652 Bacteria 5423
16 Ga0466705_055335 3300042612 Bacteria 2044
17 Ga0415639_265569 3300038395 Bacteria 1823
18 Ga0466697_053946 3300042611 Bacteria 1220
19 Ga0123357_10236827 3300009784 Bacteria 1986
20 Ga0123353_10001625 3300010167 Bacteria 27660
21 Ga0123353_10004539 3300010167 Bacteria 17893
22 JGI24702J35022_10000051 3300002462 Bacteria 49678
23 JGI24702J35022_10031960 3300002462 Bacteria 2818
24 JGI24699J35502_11133956 3300002509 Bacteria 21193
25 Ga0072940_1194293 3300005200 Bacteria 3399
26 Ga0466704_308286 3300042643 Bacteria 8912
27 Ga0466708_169297 3300042652 Bacteria 4521
28 Ga0160453_104730 3300012814 Bacteria 2407
29 Ga0160441_100619 3300012825 Bacteria 22203
30 Ga0160431_104490 3300012828 Unclassified 2560
31 Ga0160430_100223 3300012852 Unclassified 40599
32 Ga0466696_406944 3300042596 Bacteria 3123
33 Ga0123354_10184550 3300010882 Bacteria 2365
34 Ga0466718_104812 3300042617 Bacteria 3663
35 JGI24695J34938_10013289 3300002450 Bacteria 4330
36 Ga0466729_223884 3300042621 Bacteria 8279
37 Ga0466735_072348 3300042624 Bacteria 2795
38 Ga0160469_106816 3300012824 Bacteria 1115
39 Ga0466693_009130 3300042592 Bacteria 34029
40 Ga0466693_199637 3300042592 Bacteria 2534
41 Ga0466713_124578 3300042602 Bacteria 10521
42 Ga0160442_100013 3300012806 Bacteria 424413
43 IMNBGM34_c012716 3300000036 Bacteria 1053
44 JGI24696J40584_12702037 3300002834 Unclassified 739
45 Ga0466725_339150 3300042654 Bacteria 2982
46 Ga0160441_100888 3300012825 Unclassified 14401
47 Ga0160434_102452 3300012850 Bacteria 3213
48 Ga0160430_101858 3300012852 Bacteria 7292
49 Ga0160448_120488 3300012854 Bacteria 1081
50 Ga0160435_1001863 3300012857 Bacteria 5201
51 Ga0160435_1024758 3300012857 Bacteria 1013
52 Ga0160457_1001653 3300012858 Bacteria 5779
53 Ga0466690_150313 3300042590 Bacteria 2085
54 Ga0123356_10026463 3300010049 Bacteria 5445
55 Ga0160464_101959 3300012805 Unclassified 4794
56 Ga0466710_167270 3300042613 Bacteria 5850
57 Ga0466726_120148 3300042619 Bacteria 1313
58 JGI24702J35022_10160994 3300002462 Bacteria 1264
59 JGI24699J35502_11132018 3300002509 Unclassified 6282
60 Ga0466730_046187 3300042625 Bacteria 9232
61 Ga0466730_086474 3300042625 Bacteria 14684
62 Ga0466733_132992 3300042659 Bacteria 10463
63 Ga0562375_0003 3300056856 Bacteria 3519784
64 Ga0160430_110087 3300012852 Unclassified 1651
65 Ga0123357_10037889 3300009784 Bacteria 6564
66 Ga0123356_10002457 3300010049 Bacteria 19780
67 Ga0123356_10013768 3300010049 Bacteria 7790
68 Ga0123353_10007738 3300010167 Bacteria 14578
69 Ga0123353_10090620 3300010167 Bacteria 4924
70 Ga0123353_10575463 3300010167 Bacteria 1617
71 Ga0123354_10007292 3300010882 Bacteria 16607
72 Ga0466718_046777 3300042617 Bacteria 2889
73 Ga0466718_107382 3300042617 Bacteria 1509
74 JGI24699J35502_11080507 3300002509 Bacteria 1968
75 Ga0466730_007333 3300042625 Bacteria 40359
76 Ga0466730_074914 3300042625 Unclassified 2704
77 Ga0466730_098463 3300042625 Bacteria 1404
78 Ga0466703_394142 3300042636 Bacteria 3177
79 Ga0466724_03053 3300042649 Bacteria 12160
80 Ga0466733_198172 3300042659 Bacteria 1085
81 Ga0562379_0382 3300056790 Bacteria 101272
82 Ga0562375_0307 3300056856 Bacteria 120979
83 Ga0562375_2596 3300056856 Unclassified 19677
84 Ga0562376_1645 3300056857 Bacteria 30276
85 Ga0160453_105179 3300012814 Unclassified 2189
86 Ga0160432_100781 3300012818 Unclassified 15208
87 Ga0160456_102692 3300012820 Unclassified 3095
88 Ga0160445_100011 3300012847 Bacteria 286054
89 Ga0160434_100015 3300012850 Bacteria 213534
90 Ga0466693_288026 3300042592 Bacteria 10708
91 Ga0466706_101513 3300042599 Bacteria 10282
92 Ga0466722_038562 3300042609 Bacteria 1524
93 Ga0123356_10567310 3300010049 Bacteria 1297
94 Ga0160471_104799 3300012812 Bacteria 1857
95 JGI24705J35276_12225018 3300002504 Bacteria 2673
96 Ga0068305_10207484 3300005083 Bacteria 4401
97 Ga0466730_021167 3300042625 Bacteria 1668
98 Ga0466709_187281 3300042648 Bacteria 20491
99 Ga0466725_049230 3300042654 Bacteria 2690
100 Ga0466733_038009 3300042659 Bacteria 25950
101 Ga0562378_2424 3300056814 Unclassified 15548
102 Ga0160432_100749 3300012818 Bacteria 16191
103 Ga0160452_102324 3300012834 Bacteria 4141
104 Ga0160443_100179 3300012848 Bacteria 86080
105 Ga0466656_324299 3300042550 Bacteria 1036
106 Ga0466693_338701 3300042592 Bacteria 160829
107 Ga0123357_10166219 3300009784 Bacteria 2626
108 Ga0123356_11046530 3300010049 Bacteria 986
109 Ga0123353_10001458 3300010167 Bacteria 28930
110 Ga0123353_10183888 3300010167 Bacteria 3306
111 Ga0466711_119849 3300042615 Bacteria 7233
112 JGI24699J35502_11132904 3300002509 Bacteria 7929
113 Ga0466730_093621 3300042625 Bacteria 3603

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01765 RRF Ribosome recycling factor 56 218 0.99

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.