Protein Family IF08975
Metagenome
Isolate
271
Members
169
Samples
164
Scaffolds
84.59
Avg Length
Representative Sequence
- ID
- 3300042625|Ga0466730_058700|Ga0466730_058700_284_577
- Length
- 97 aa
- Sequence
- MAHKKGASSSRNGRDSNAQRLGVKRFGGQVVNAGEILVRQRGTHFHPGVGVGRGGDDTLFALVAGRVEFGSRRGRRAVSVVPVAESARAETATAKAS
Sample Types
Isolate
39.5%
Metagenome
60.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
28.2%
Termitidae
19.0%
Formicidae
11.7%
Apidae
9.2%
Kalotermitidae
7.4%
Tenebrionidae
4.9%
Cambaridae
3.7%
Culicidae
2.5%
Elmidae
2.5%
Armadillidiidae
1.2%
Rhinotermitidae
1.2%
Hydrophilidae
1.2%
Termopsidae
1.2%
Cimicidae
0.6%
Chironomidae
0.6%
Ixodidae
0.6%
Curculionidae
0.6%
Hodotermitidae
0.6%
Siricidae
0.6%
Scarabaeidae
0.6%
Pentatomidae
0.6%
Pyralidae
0.6%
Reduviidae
0.6%
Taxonomy
Archaea
0
Bacteria
258
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2513237174 | Bifidobacterium asteroides ATCC 25910 | Isolate | Apidae |
| 2 | 2671180625 | Pseudonocardia sp. EC080619-01 | Isolate | Formicidae |
| 3 | 2675903013 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 4 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 5 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 6 | 2820849606 | Unclassified Actinobacteria Lab288P3bin39 | Isolate | Unclassified |
| 7 | 2820889385 | Unclassified Actinobacteria Lab288P1bin133 | Isolate | Unclassified |
| 8 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 9 | 2824199081 | Bifidobacterium commune DSM 28792 | Isolate | Unclassified |
| 10 | 2915166107 | Leucobacter sp. cx-87 | Isolate | Cambaridae |
| 11 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 12 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 13 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 14 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 15 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 16 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 17 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 18 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 19 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 20 | 646564587 | Tsukamurella paurometabola 33, DSM 20162 | Isolate | Cimicidae |
| 21 | 8077775691 | Tsukamurella sp. PLM1 | Isolate | Formicidae |
| 22 | 8077783556 | Streptomyces sp. PLM4 | Isolate | Formicidae |
| 23 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 24 | 3006468911 | Streptomyces sp. RB17 | Isolate | Termitidae |
| 25 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 26 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 27 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 28 | 8118075156 | Actinosynnema pretiosum DSM 44131 | Isolate | Unclassified |
| 29 | 2820882373 | Unclassified Actinobacteria Lab288P1bin45 | Isolate | Unclassified |
| 30 | 2856652821 | Actinomadura rubteroloni RB29 | Isolate | Unclassified |
| 31 | 2856671350 | Pseudonocardia sp. Ae356_Ps1 | Isolate | Formicidae |
| 32 | 2856947901 | Pseudonocardia sp. Ae168_Ps1 | Isolate | Formicidae |
| 33 | 2864899338 | Mycobacteroides chelonae S00154 | Isolate | Elmidae |
| 34 | 2873196663 | Streptomyces capitiformicae 1H-SSA4 | Isolate | Formicidae |
| 35 | 2908241010 | Streptomyces sp. HF10 | Isolate | Termitidae |
| 36 | 2912817845 | Streptomyces griseus SID164 | Isolate | |
| 37 | 2918390780 | Glutamicibacter protophormiae DSM 20168 | Isolate | Unclassified |
| 38 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 39 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 40 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 41 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 42 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 43 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 44 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 45 | 8024981139 | Bifidobacterium asteroides ESL0170 | Isolate | Apidae |
| 46 | 8024984606 | Bifidobacterium asteroides ESL0199 | Isolate | Apidae |
| 47 | 8030347546 | Propionimicrobium sp. PCR01-08-3 | Isolate | Tenebrionidae |
| 48 | 2515154100 | Streptomyces sp. MspMP-M5 | Isolate | Unclassified |
| 49 | 2515154104 | Streptomyces sp. KhCrAH-244 | Isolate | Unclassified |
| 50 | 2519899775 | Bifidobacterium asteroides PRL2011 | Isolate | Apidae |
| 51 | 2524023214 | Leucobacter chironomi DSM 19883 | Isolate | Chironomidae |
| 52 | 2675903497 | Pseudonocardia sp. EC080610-09 | Isolate | Formicidae |
| 53 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 54 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 55 | 2820914081 | Unclassified Actinobacteria Emb289P3bin87 | Isolate | Unclassified |
| 56 | 2856966858 | Pseudonocardia sp. Ae263_Ps1 | Isolate | Formicidae |
| 57 | 2862075925 | Corynebacterium lactis S064 | Isolate | Ixodidae |
| 58 | 2896955351 | Streptomyces sp. GF20 | Isolate | Termitidae |
| 59 | 2910090113 | Kocuria sp. cx-116 | Isolate | Cambaridae |
| 60 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 61 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 62 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 63 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 64 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 65 | 647000328 | Streptomyces sp. ACT-1 XylebKG-1 | Isolate | Curculionidae |
| 66 | 649989992 | Pseudonocardia sp. P1 | Isolate | Formicidae |
| 67 | 8053361298 | Streptomyces formicae 1H-GS9 | Isolate | Unclassified |
| 68 | 8073544309 | Actinomadura sp. RB99 | Isolate | Termitidae |
| 69 | 2515154106 | Streptomyces sp. FxanaD5 | Isolate | Unclassified |
| 70 | 2518645556 | Nocardiopsis alba ATCC BAA-2165 | Isolate | Apidae |
| 71 | 2547132042 | Pseudonocardia sp. P2 | Isolate | Formicidae |
| 72 | 2718217924 | Pseudonocardia sp. HH130630-07 | Isolate | Formicidae |
| 73 | 2772190761 | Rhodococcus rhodnii NRRL B-16535 | Isolate | Unclassified |
| 74 | 2808606957 | Bifidobacterium sp. ESL0447 | Isolate | Unclassified |
| 75 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 76 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 77 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 78 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 79 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 80 | 2820803007 | Unclassified Actinobacteria Th196P3bin61 | Isolate | Unclassified |
| 81 | 2820838073 | Unclassified Actinobacteria Lab288P4bin27 | Isolate | Unclassified |
| 82 | 2820842553 | Unclassified Actinobacteria Lab288P4bin104 | Isolate | Unclassified |
| 83 | 2856960404 | Pseudonocardia sp. Ae706_Ps2 | Isolate | Formicidae |
| 84 | 2856973192 | Pseudonocardia sp. Ae331_Ps2 | Isolate | Formicidae |
| 85 | 2859970369 | Pseudonocardia sp. Ae717_Ps2 | Isolate | Formicidae |
| 86 | 2862784999 | Streptomyces sp. M41 | Isolate | Unclassified |
| 87 | 2863397684 | Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) | Isolate | Unclassified |
| 88 | 2864773010 | Tsukamurella ocularis S00022 | Isolate | Elmidae |
| 89 | 2909412500 | Yimella sp. cx-573 | Isolate | Cambaridae |
| 90 | 2931430189 | Tessaracoccus palaemonis J1M15 | Isolate | |
| 91 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 92 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 93 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 94 | 2597490194 | Bifidobacterium coryneforme LMG 18911 | Isolate | Apidae |
| 95 | 2648501322 | Streptomyces sp. SA3_actF | Isolate | Unclassified |
| 96 | 2671180601 | Bifidobacterium asteroides DSM 20089 | Isolate | Unclassified |
| 97 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 98 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 99 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 100 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 101 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 102 | 2820814774 | Unclassified Actinobacteria Nt197P3bin39 | Isolate | Unclassified |
| 103 | 2820816657 | Unclassified Actinobacteria Nt197P3bin38 | Isolate | Unclassified |
| 104 | 2820901319 | Unclassified Actinobacteria Emb289P4bin58 | Isolate | Unclassified |
| 105 | 2856882415 | Pseudonocardia sp. Ae406_Ps2 | Isolate | Formicidae |
| 106 | 2859977607 | Pseudonocardia sp. Ae707_Ps1 | Isolate | Formicidae |
| 107 | 2864964650 | Tsukamurella ocularis S00236 | Isolate | Elmidae |
| 108 | 2873558832 | Propioniciclava coleopterorum HDW11 | Isolate | Hydrophilidae |
| 109 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 110 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 111 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 112 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 113 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 114 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 115 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 116 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 117 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 118 | 8046957834 | Streptomyces coacervatus JCM 17138 | Isolate | Unclassified |
| 119 | 8109397740 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 120 | 2523533511 | Streptomyces sp. Sv. ACTE SirexAA-E | Isolate | Siricidae |
| 121 | 2568526170 | Bifidobacterium sp. A11 | Isolate | Apidae |
| 122 | 2684622919 | Bifidobacterium asteroides Bi_199 | Isolate | Unclassified |
| 123 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 124 | 2820857933 | Unclassified Actinobacteria Lab288P3bin173 | Isolate | Unclassified |
| 125 | 2820863028 | Unclassified Actinobacteria Lab288P3bin164 | Isolate | Unclassified |
| 126 | 2852016966 | Micromonospora polyrhachis DSM 45886 | Isolate | Unclassified |
| 127 | 2883683260 | Protaetiibacter larvae KACC 19322 | Isolate | Scarabaeidae |
| 128 | 2898589227 | Actinomadura macrotermitis RB68 | Isolate | Termitidae |
| 129 | 2915168811 | Leucobacter sp. cx-169 | Isolate | Cambaridae |
| 130 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 131 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 132 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 133 | 2873603790 | Tessaracoccus coleopterorum HDW20 | Isolate | Hydrophilidae |
| 134 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 135 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 136 | 8032009961 | Bifidobacterium indicum ESL0197 | Isolate | Apidae |
| 137 | 2684622920 | Bifidobacterium asteroides Bi_200 | Isolate | Unclassified |
| 138 | 2802429577 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 139 | 2818991478 | Micromonospora palomenae DSM 102131 | Isolate | Pentatomidae |
| 140 | 3006461590 | Streptomyces sp. RB5 | Isolate | Termitidae |
| 141 | 3006667155 | Streptomyces sp. SID9727 | Isolate | |
| 142 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 143 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 144 | 2820809073 | Unclassified Actinobacteria Nt197P3bin55 | Isolate | Unclassified |
| 145 | 2820867525 | Unclassified Actinobacteria Lab288P3bin128 | Isolate | Unclassified |
| 146 | 2820903739 | Unclassified Actinobacteria Emb289P4bin49 | Isolate | Unclassified |
| 147 | 2856954254 | Pseudonocardia sp. Ae505_Ps2 | Isolate | Formicidae |
| 148 | 2864918810 | Tsukamurella ocularis S00175 | Isolate | Elmidae |
| 149 | 2879643867 | Bifidobacterium sp. wkB344 | Isolate | Apidae |
| 150 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 151 | 2912749649 | Streptomyces sp. GS7 | Isolate | Termitidae |
| 152 | 8062747827 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 153 | 2545824723 | Rhodococcus rhodnii LMG 5362 | Isolate | Reduviidae |
| 154 | 2547132081 | Streptomyces sp. S4 | Isolate | Formicidae |
| 155 | 2660238275 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 156 | 2684622916 | Bifidobacterium asteroides Bi_170 | Isolate | Unclassified |
| 157 | 2684622917 | Bifidobacterium coryneforme Bi_197 | Isolate | Unclassified |
| 158 | 2693429521 | Bifidobacterium coryneforme DSM 20216 | Isolate | Unclassified |
| 159 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 160 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 161 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 162 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 163 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 164 | 2820911766 | Unclassified Actinobacteria Emb289P3bin96 | Isolate | Unclassified |
| 165 | 2909881144 | Kocuria sp. cx-455 | Isolate | Cambaridae |
| 166 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 167 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 168 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 169 | 8024982947 | Bifidobacterium asteroides ESL0200 | Isolate | Apidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0530661_000049 | 3300056564 | Unclassified | 132096 |
| 2 | Ga0466711_080233 | 3300042615 | Unclassified | 1627 |
| 3 | Ga0466729_095354 | 3300042621 | Bacteria | 4686 |
| 4 | Ga0160445_118072 | 3300012847 | Bacteria | 953 |
| 5 | Ga0160436_1016422 | 3300012861 | Bacteria | 1480 |
| 6 | Ga0466706_050657 | 3300042599 | Bacteria | 16588 |
| 7 | Ga0123356_10020744 | 3300010049 | Bacteria | 6214 |
| 8 | Ga0123356_10481784 | 3300010049 | Bacteria | 1394 |
| 9 | Ga0123356_13794819 | 3300010049 | Bacteria | 522 |
| 10 | Ga0123353_10001044 | 3300010167 | Unclassified | 33949 |
| 11 | Ga0123354_10614722 | 3300010882 | Bacteria | 790 |
| 12 | Ga0466705_235135 | 3300042612 | Bacteria | 7101 |
| 13 | Ga0466730_041842 | 3300042625 | Bacteria | 5940 |
| 14 | Ga0466730_057353 | 3300042625 | Bacteria | 1443 |
| 15 | Ga0466730_096853 | 3300042625 | Bacteria | 6948 |
| 16 | Ga0466703_058286 | 3300042636 | Bacteria | 1732 |
| 17 | Ga0466703_116269 | 3300042636 | Bacteria | 6196 |
| 18 | Ga0466703_221819 | 3300042636 | Bacteria | 2542 |
| 19 | Ga0466703_295129 | 3300042636 | Bacteria | 27735 |
| 20 | Ga0466708_205207 | 3300042652 | Bacteria | 72189 |
| 21 | Ga0562375_4187 | 3300056856 | Bacteria | 11488 |
| 22 | JGI24703J35330_11547494 | 3300002501 | Bacteria | 1218 |
| 23 | Ga0072941_1032835 | 3300005201 | Bacteria | 11198 |
| 24 | Ga0074278_149298 | 3300005721 | Bacteria | 2738 |
| 25 | Ga0466705_429111 | 3300042612 | Bacteria | 3917 |
| 26 | Ga0466710_322904 | 3300042613 | Bacteria | 1927 |
| 27 | Ga0466711_058620 | 3300042615 | Bacteria | 2930 |
| 28 | Ga0466728_167206 | 3300042620 | Bacteria | 1402 |
| 29 | Ga0160435_1000453 | 3300012857 | Bacteria | 14022 |
| 30 | Ga0466693_056620 | 3300042592 | Bacteria | 145249 |
| 31 | Ga0466701_054985 | 3300042598 | Bacteria | 1238 |
| 32 | Ga0466707_079628 | 3300042601 | Bacteria | 5232 |
| 33 | Ga0466722_192725 | 3300042609 | Bacteria | 2028 |
| 34 | Ga0123356_10006279 | 3300010049 | Bacteria | 12002 |
| 35 | Ga0123354_10000030 | 3300010882 | Bacteria | 106941 |
| 36 | Ga0466730_032184 | 3300042625 | Bacteria | 1186 |
| 37 | Ga0466730_084127 | 3300042625 | Bacteria | 1642 |
| 38 | Ga0466730_093379 | 3300042625 | Bacteria | 2320 |
| 39 | AustNasuHG_c1000299 | 3300000089 | Bacteria | 17184 |
| 40 | JGI24699J35502_10960193 | 3300002509 | Bacteria | 1201 |
| 41 | Ga0072940_1010744 | 3300005200 | Unclassified | 3091 |
| 42 | Ga0102736_1038103 | 3300007052 | Bacteria | 585 |
| 43 | Ga0123357_10000327 | 3300009784 | Bacteria | 45136 |
| 44 | Ga0466711_104350 | 3300042615 | Bacteria | 41581 |
| 45 | Ga0466715_134409 | 3300042616 | Bacteria | 1169 |
| 46 | Ga0466715_499818 | 3300042616 | Unclassified | 8321 |
| 47 | Ga0466718_003202 | 3300042617 | Bacteria | 5397 |
| 48 | Ga0466729_002672 | 3300042621 | Bacteria | 9564 |
| 49 | Ga0466657_256572 | 3300042582 | Bacteria | 5511 |
| 50 | Ga0466707_382854 | 3300042601 | Bacteria | 200054 |
| 51 | Ga0466713_080541 | 3300042602 | Bacteria | 9968 |
| 52 | Ga0123357_10408800 | 3300009784 | Bacteria | 1226 |
| 53 | Ga0123355_11335559 | 3300009826 | Bacteria | 715 |
| 54 | Ga0123356_13875255 | 3300010049 | Bacteria | 516 |
| 55 | Ga0466730_060058 | 3300042625 | Bacteria | 1848 |
| 56 | Ga0466703_318602 | 3300042636 | Bacteria | 18933 |
| 57 | Ga0466733_054324 | 3300042659 | Bacteria | 6519 |
| 58 | Ga0466733_144465 | 3300042659 | Bacteria | 21475 |
| 59 | Ga0562375_1767 | 3300056856 | Bacteria | 27093 |
| 60 | Ga0562374_0184 | 3300057007 | Bacteria | 137353 |
| 61 | JGI24702J35022_10303045 | 3300002462 | Unclassified | 943 |
| 62 | JGI24699J35502_11133573 | 3300002509 | Unclassified | 12087 |
| 63 | Ga0123357_10000103 | 3300009784 | Bacteria | 70483 |
| 64 | Ga0466711_006528 | 3300042615 | Bacteria | 8194 |
| 65 | Ga0466711_302554 | 3300042615 | Bacteria | 1598 |
| 66 | Ga0466729_113445 | 3300042621 | Bacteria | 1550 |
| 67 | Ga0160447_100305 | 3300012849 | Bacteria | 25676 |
| 68 | Ga0160430_102357 | 3300012852 | Bacteria | 6036 |
| 69 | Ga0466706_246026 | 3300042599 | Bacteria | 14531 |
| 70 | Ga0466707_269543 | 3300042601 | Bacteria | 52716 |
| 71 | Ga0466713_032194 | 3300042602 | Bacteria | 9576 |
| 72 | Ga0466713_128512 | 3300042602 | Bacteria | 3652 |
| 73 | Ga0466722_250163 | 3300042609 | Bacteria | 2197 |
| 74 | Ga0123357_10517294 | 3300009784 | Bacteria | 978 |
| 75 | Ga0123356_10004579 | 3300010049 | Bacteria | 14253 |
| 76 | Ga0466705_162860 | 3300042612 | Bacteria | 4662 |
| 77 | Ga0466705_304441 | 3300042612 | Bacteria | 1957 |
| 78 | Ga0466724_36962 | 3300042649 | Bacteria | 194212 |
| 79 | Ga0466725_362223 | 3300042654 | Unclassified | 1215 |
| 80 | Ga0562379_4555 | 3300056790 | Bacteria | 6782 |
| 81 | Ga0562377_0055 | 3300056842 | Bacteria | 513141 |
| 82 | AustNasuHG_c1022913 | 3300000089 | Bacteria | 2000 |
| 83 | Ga0072941_1170548 | 3300005201 | Bacteria | 1281 |
| 84 | Ga0466705_399329 | 3300042612 | Bacteria | 7791 |
| 85 | Ga0466706_270674 | 3300042599 | Bacteria | 4453 |
| 86 | Ga0466713_003732 | 3300042602 | Bacteria | 1219 |
| 87 | Ga0466717_118015 | 3300042604 | Bacteria | 2424 |
| 88 | Ga0466722_063674 | 3300042609 | Bacteria | 1129 |
| 89 | Ga0123357_10007646 | 3300009784 | Bacteria | 13397 |
| 90 | Ga0123356_11907446 | 3300010049 | Bacteria | 740 |
| 91 | Ga0123356_13406340 | 3300010049 | Bacteria | 552 |
| 92 | Ga0123353_10007899 | 3300010167 | Bacteria | 14454 |
| 93 | Ga0123353_11220036 | 3300010167 | Bacteria | 985 |
| 94 | Ga0123353_13263642 | 3300010167 | Bacteria | 518 |
| 95 | Ga0123354_10006692 | 3300010882 | Bacteria | 17178 |
| 96 | Ga0466730_030718 | 3300042625 | Bacteria | 5291 |
| 97 | Ga0466730_058854 | 3300042625 | Bacteria | 41696 |
| 98 | Ga0466704_412447 | 3300042643 | Bacteria | 22706 |
| 99 | Ga0562374_0248 | 3300057007 | Bacteria | 108733 |
| 100 | Ga0466715_166874 | 3300042616 | Bacteria | 3190 |
| 101 | Ga0466715_234718 | 3300042616 | Bacteria | 17821 |
| 102 | Ga0466715_549543 | 3300042616 | Bacteria | 1594 |
| 103 | Ga0466723_028909 | 3300042618 | Bacteria | 1010 |
| 104 | Ga0466691_008350 | 3300042593 | Bacteria | 4343 |
| 105 | Ga0466706_139052 | 3300042599 | Bacteria | 1245 |
| 106 | Ga0466707_185912 | 3300042601 | Bacteria | 1213 |
| 107 | Ga0466707_202363 | 3300042601 | Bacteria | 7285 |
| 108 | Ga0466707_238952 | 3300042601 | Bacteria | 1021 |
| 109 | Ga0466713_033776 | 3300042602 | Bacteria | 10733 |
| 110 | Ga0466713_110315 | 3300042602 | Bacteria | 1966 |
| 111 | Ga0466717_074778 | 3300042604 | Bacteria | 3663 |
| 112 | Ga0466719_128552 | 3300042606 | Bacteria | 1496 |
| 113 | Ga0466719_130625 | 3300042606 | Bacteria | 43197 |
| 114 | Ga0466722_242082 | 3300042609 | Bacteria | 6928 |
| 115 | Ga0123356_10000055 | 3300010049 | Bacteria | 121074 |
| 116 | Ga0123353_10033881 | 3300010167 | Bacteria | 7959 |
| 117 | Ga0123353_10141517 | 3300010167 | Bacteria | 3853 |
| 118 | Ga0123353_10466234 | 3300010167 | Bacteria | 1854 |
| 119 | Ga0123353_11085915 | 3300010167 | Bacteria | 1064 |
| 120 | Ga0466697_191092 | 3300042611 | Bacteria | 1985 |
| 121 | Ga0466734_099109 | 3300042623 | Bacteria | 1233 |
| 122 | Ga0466730_058700 | 3300042625 | Bacteria | 4300 |
| 123 | Ga0466703_290586 | 3300042636 | Bacteria | 51739 |
| 124 | Ga0466723_020758 | 3300042618 | Bacteria | 1168 |
| 125 | Ga0160443_115799 | 3300012848 | Bacteria | 817 |
| 126 | Ga0160448_100644 | 3300012854 | Bacteria | 11736 |
| 127 | Ga0160436_1010638 | 3300012861 | Bacteria | 1995 |
| 128 | Ga0466657_254544 | 3300042582 | Bacteria | 1010 |
| 129 | Ga0466706_080441 | 3300042599 | Bacteria | 247551 |
| 130 | Ga0466707_334896 | 3300042601 | Bacteria | 10519 |
| 131 | Ga0466713_105765 | 3300042602 | Bacteria | 92337 |
| 132 | Ga0466698_252568 | 3300042610 | Bacteria | 1712 |
| 133 | Ga0123353_10099973 | 3300010167 | Unclassified | 4675 |
| 134 | Ga0123353_11251178 | 3300010167 | Unclassified | 969 |
| 135 | Ga0466735_091182 | 3300042624 | Bacteria | 1181 |
| 136 | Ga0466703_009456 | 3300042636 | Bacteria | 1339 |
| 137 | Ga0466703_410745 | 3300042636 | Bacteria | 2632 |
| 138 | Ga0466725_391649 | 3300042654 | Bacteria | 5297 |
| 139 | Ga0466727_064983 | 3300042655 | Bacteria | 3834 |
| 140 | Ga0530661_000439 | 3300056564 | Bacteria | 30933 |
| 141 | Ga0562378_0311 | 3300056814 | Bacteria | 99882 |
| 142 | Ga0562375_0002 | 3300056856 | Bacteria | 3523859 |
| 143 | Ga0562376_0018 | 3300056857 | Bacteria | 481690 |
| 144 | HBC_ctgsDRAFT_1029499 | 3300000333 | Bacteria | 1348 |
| 145 | JGI24699J35502_11132623 | 3300002509 | Bacteria | 7230 |
| 146 | Ga0466718_134793 | 3300042617 | Bacteria | 2487 |
| 147 | Ga0466728_045005 | 3300042620 | Unclassified | 18537 |
| 148 | Ga0466728_240065 | 3300042620 | Bacteria | 1497 |
| 149 | Ga0466657_366320 | 3300042582 | Bacteria | 4842 |
| 150 | Ga0466690_205002 | 3300042590 | Unclassified | 1076 |
| 151 | Ga0466696_224055 | 3300042596 | Bacteria | 5702 |
| 152 | Ga0466696_389876 | 3300042596 | Bacteria | 2164 |
| 153 | Ga0466706_115874 | 3300042599 | Bacteria | 14990 |
| 154 | Ga0466700_419037 | 3300042600 | Bacteria | 9273 |
| 155 | Ga0466707_061355 | 3300042601 | Bacteria | 1348 |
| 156 | Ga0466707_192883 | 3300042601 | Unclassified | 2150 |
| 157 | Ga0466707_413621 | 3300042601 | Bacteria | 1269 |
| 158 | Ga0123355_10026494 | 3300009826 | Bacteria | 9353 |
| 159 | Ga0123353_12623085 | 3300010167 | Bacteria | 596 |
| 160 | Ga0123354_10115004 | 3300010882 | Bacteria | 3520 |
| 161 | Ga0160466_100001 | 3300012809 | Bacteria | 656346 |
| 162 | Ga0466705_126112 | 3300042612 | Bacteria | 4425 |
| 163 | Ga0466704_455742 | 3300042643 | Bacteria | 18184 |
| 164 | Ga0466727_173761 | 3300042655 | Bacteria | 4499 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01016 | Ribosomal_L27 | Ribosomal L27 protein | 2 | 80 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.