Protein Family IF08820

Metagenome Isolate
139 Members
61 Samples
108 Scaffolds
374.26 Avg Length

🧬 Representative Sequence

ID
3300042624|Ga0466735_163203|Ga0466735_163203_24389_25558
Length
389 aa
Sequence
VIECGSYQLIKKSSECMARRGKVYTVRGIIDTPVFMPVGTQGSVKGVATEFLKGSGAQIILANSYHLYLRPGTEVIKKAGGIQKFNSWNSPMLTDSXXXXMFSLSDIRKITEDGTEFQSYIDGSKHFFSPEKSMQVQKDIGADIIMCFDECTPYCSDYGYAKKSMELNLKWAKRCKEEFYKDDSYKTQSLFGIIQGSVYDDLRIKSAWEMLSVGFTGYAVGGLSVGEPKKSMHSVLENVLPIIPENKARYLMGVGMPEDLWECVERGIDMFDCVIPTRNGRNGQVFTSLGKINLRNAEFKKDFSSLDPDCACPACAGYSKAYLNHLIRSRETLYLSLLSLHNIYFMLGLMVKIRKSLEDDTFFKSKREFFEKYYLRNRSRFSKNLCSKK

📊 Sample Types

Isolate 22.3%
Metagenome 77.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 23.0%
Unclassified 16.4%
Blaberidae 13.1%
Termitidae 9.8%
Termopsidae 6.6%
Blattellidae 4.9%
Ectobiidae 3.3%
Corydiidae 3.3%
Rhinotermitidae 3.3%
Anaplectidae 3.3%
Nyctiboridae 3.3%
Blattidae 3.3%
Hodotermitidae 1.6%
Ixodidae 1.6%
Tryonicidae 1.6%
Pseudophyllodromiidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 119
Eukaryota 0
Viruses 0
Unclassified 20

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2772190889 Unclassified Elusimicrobia Cu122P5_bin43 Isolate Unclassified
2 3002024525 Blattabacterium cuenoti EPILAmay Isolate Blaberidae
3 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
4 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
5 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
6 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
7 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
8 2754412482 Unclassified Elusimicrobia Emb289P3bin85 Isolate Unclassified
9 2518645548 Blattabacterium sp. (Blaberus giganteus) Isolate Blaberidae
10 3002027480 Blattabacterium cuenoti SCHULTlam Isolate Unclassified
11 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
12 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
13 650716011 Blattabacterium sp. Bge Isolate Blattellidae
14 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
15 2772190894 Unclassified Elusimicrobia Th196P4_bin33 Isolate Unclassified
16 2599185121 Rickettsiales bacterium Ac37b Isolate Ixodidae
17 3002002099 Blattabacterium cuenoti ECTONUhan Isolate Ectobiidae
18 3002004002 Blattabacterium cuenoti EUPOLsin Isolate Corydiidae
19 3002006476 Blattabacterium cuenoti GYNAcap Isolate Blaberidae
20 3002032411 Blattabacterium cuenoti POLYPHAGsp Isolate Corydiidae
21 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
22 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
23 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
24 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
25 2772190893 Unclassified Elusimicrobia Nt197P4_bin29 Isolate Unclassified
26 3001995955 Blattabacterium cuenoti ANAPcal Isolate Anaplectidae
27 3002022645 Blattabacterium cuenoti TRYONIpar Isolate Tryonicidae
28 3002029927 Blattabacterium cuenoti CHORISOsp Isolate Pseudophyllodromiidae
29 3002031185 Blattabacterium cuenoti OPISTHori Isolate Blaberidae
30 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
31 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
32 2561511170 Blattabacterium sp. (Blatta orientalis) Tarazona Isolate Unclassified
33 3002005847 Blattabacterium cuenoti ECTOBIsp Isolate Ectobiidae
34 3002007740 Blattabacterium cuenoti NYCTIBsp Isolate Nyctiboridae
35 3002023891 Blattabacterium cuenoti MEGALOsp Isolate Nyctiboridae
36 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
37 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
38 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
39 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
40 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
41 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
42 3002004631 Blattabacterium cuenoti ANAPome Isolate Anaplectidae
43 3002033046 Blattabacterium cuenoti ANALLAmet Isolate Blattellidae
44 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
45 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
46 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
47 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
48 646311912 Blattabacterium sp. BPLAN Isolate Blattidae
49 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
50 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
51 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
52 3002026852 Blattabacterium cuenoti BEYBkur Isolate Blattellidae
53 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
54 2772190892 Unclassified Elusimicrobia Lab288P3_bin37 Isolate Unclassified
55 3002005207 Blattabacterium cuenoti MELANOZsp Isolate Blattidae
56 3002007112 Blattabacterium cuenoti CYRTOsp Isolate Blaberidae
57 3002023256 Blattabacterium cuenoti RHABDOBsp Isolate Blaberidae
58 3002030550 Blattabacterium cuenoti NEOLAXmac Isolate Blaberidae
59 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
60 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
61 8071415077 Blattabacterium cuenoti MACROPArhi Isolate Blaberidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466707_357026 3300042601 Bacteria 7258
2 Ga0466713_028532 3300042602 Unclassified 2811
3 Ga0466716_175038 3300042605 Unclassified 7015
4 Ga0466690_087286 3300042590 Unclassified 8871
5 Ga0466690_180876 3300042590 Bacteria 31636
6 Ga0466690_287104 3300042590 Bacteria 22096
7 Ga0466696_202836 3300042596 Unclassified 25801
8 Ga0466711_493807 3300042615 Bacteria 45943
9 Ga0466723_126625 3300042618 Bacteria 1263
10 Ga0466726_337633 3300042619 Bacteria 39129
11 Ga0466728_380833 3300042620 Bacteria 49387
12 Ga0466729_127141 3300042621 Bacteria 5187
13 Ga0068305_10000131 3300005083 Bacteria 190192
14 Ga0466729_259773 3300042621 Bacteria 2808
15 Ga0466735_019684 3300042624 Bacteria 12007
16 Ga0466704_602570 3300042643 Bacteria 18095
17 Ga0466713_051451 3300042602 Bacteria 53134
18 Ga0466714_131668 3300042603 Bacteria 15567
19 Ga0466690_069955 3300042590 Bacteria 6484
20 Ga0466715_571813 3300042616 Bacteria 4444
21 Ga0466715_627388 3300042616 Bacteria 115089
22 Ga0466723_090577 3300042618 Bacteria 13138
23 JGI24705J35276_12238806 3300002504 Bacteria 109319
24 Ga0068305_10001537 3300005083 Bacteria 36494
25 Ga0466735_116209 3300042624 Bacteria 6158
26 Ga0466735_153444 3300042624 Bacteria 2878
27 Ga0466703_373748 3300042636 Bacteria 99169
28 Ga0466704_063191 3300042643 Bacteria 120263
29 Ga0466706_155209 3300042599 Bacteria 186431
30 Ga0466707_013650 3300042601 Bacteria 197174
31 Ga0466715_141394 3300042616 Bacteria 17581
32 Ga0466723_076556 3300042618 Unclassified 18521
33 Ga0466726_165686 3300042619 Bacteria 20812
34 Ga0466728_413945 3300042620 Bacteria 40167
35 Ga0466729_088442 3300042621 Bacteria 28252
36 Ga0466735_066774 3300042624 Bacteria 6964
37 Ga0466703_151943 3300042636 Bacteria 39881
38 Ga0466704_037607 3300042643 Bacteria 18658
39 Ga0466704_230828 3300042643 Unclassified 5731
40 Ga0466704_398472 3300042643 Unclassified 5076
41 Ga0466708_328797 3300042652 Unclassified 1885
42 Ga0466707_226860 3300042601 Bacteria 13140
43 Ga0466716_320138 3300042605 Bacteria 17236
44 Ga0466690_151275 3300042590 Bacteria 5383
45 Ga0123355_10271678 3300009826 Unclassified 2354
46 Ga0123353_10247852 3300010167 Bacteria 2762
47 Ga0466715_058388 3300042616 Bacteria 6526
48 Ga0466715_066605 3300042616 Bacteria 23054
49 Ga0466723_322312 3300042618 Unclassified 14259
50 Ga0466726_038484 3300042619 Unclassified 16690
51 Ga0466726_405165 3300042619 Unclassified 4080
52 Ga0466726_460664 3300042619 Bacteria 14519
53 Ga0466728_017387 3300042620 Bacteria 16225
54 Ga0466728_040984 3300042620 Bacteria 27093
55 Ga0068302_10046259 3300005071 Unclassified 4062
56 Ga0068305_10000019 3300005083 Bacteria 30002
57 Ga0466729_198612 3300042621 Bacteria 122910
58 Ga0466735_014157 3300042624 Bacteria 27897
59 Ga0466716_297797 3300042605 Unclassified 9605
60 Ga0466719_112385 3300042606 Unclassified 15442
61 Ga0466719_294508 3300042606 Bacteria 20658
62 Ga0466719_345713 3300042606 Bacteria 3977
63 Ga0466691_091893 3300042593 Unclassified 10711
64 Ga0123357_10008349 3300009784 Bacteria 12930
65 Ga0466711_012686 3300042615 Bacteria 31029
66 Ga0466723_141698 3300042618 Bacteria 266684
67 Ga0466723_271557 3300042618 Bacteria 31425
68 Ga0466726_145651 3300042619 Bacteria 3622
69 Ga0466735_004820 3300042624 Bacteria 7391
70 Ga0466727_219994 3300042655 Bacteria 4667
71 Ga0466705_032566 3300042612 Bacteria 19403
72 Ga0466706_072463 3300042599 Bacteria 8960
73 Ga0466707_213151 3300042601 Bacteria 39169
74 Ga0466713_062934 3300042602 Bacteria 13155
75 Ga0466714_142214 3300042603 Bacteria 1987
76 Ga0123353_10000123 3300010167 Bacteria 92814
77 Ga0466726_065940 3300042619 Bacteria 154230
78 JGI24702J35022_10000633 3300002462 Unclassified 21396
79 Ga0466735_084835 3300042624 Bacteria 22781
80 Ga0466735_163203 3300042624 Bacteria 32639
81 Ga0466735_226629 3300042624 Bacteria 1963
82 Ga0466709_403433 3300042648 Unclassified 20112
83 Ga0466708_242671 3300042652 Bacteria 4566
84 Ga0466706_031300 3300042599 Bacteria 209681
85 Ga0466706_094374 3300042599 Bacteria 3160
86 Ga0466722_163351 3300042609 Bacteria 1898
87 Ga0123353_10576093 3300010167 Bacteria 1616
88 Ga0466711_258288 3300042615 Bacteria 35671
89 Ga0466715_012803 3300042616 Bacteria 41762
90 Ga0466723_262020 3300042618 Bacteria 13662
91 Ga0466726_458639 3300042619 Bacteria 4380
92 Ga0466728_176015 3300042620 Bacteria 3627
93 Ga0068305_10000087 3300005083 Bacteria 586632
94 Ga0466735_228503 3300042624 Bacteria 2589
95 Ga0466727_004981 3300042655 Bacteria 59194
96 Ga0466705_315083 3300042612 Unclassified 21789
97 Ga0466706_032922 3300042599 Bacteria 8772
98 Ga0466706_048336 3300042599 Bacteria 23602
99 Ga0466713_054647 3300042602 Bacteria 35906
100 Ga0466713_139066 3300042602 Bacteria 109882
101 Ga0466719_040767 3300042606 Bacteria 242892
102 Ga0466719_274100 3300042606 Bacteria 3253
103 Ga0466690_055751 3300042590 Bacteria 148091
104 Ga0466711_097740 3300042615 Bacteria 4261
105 Ga0068305_10000168 3300005083 Bacteria 304006
106 Ga0466735_001236 3300042624 Bacteria 7588
107 Ga0466704_017715 3300042643 Unclassified 114027
108 Ga0466727_061975 3300042655 Bacteria 1411

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01702 TGT Queuine tRNA-ribosyltransferase 17 374 0.99

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.