Protein Family IF08791
Metagenome
Isolate
232
Members
58
Samples
222
Scaffolds
153.26
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_109035|Ga0466735_109035_115_624
- Length
- 169 aa
- Sequence
- MTNNDNPYAAKSPSGDLGVNKKELQVAALKNGTVIDHIPADQLFKVVSLLGIENLKTQVTIGSGLDSKKMGKKGILKIADKFFEQNEINRISLIAPSVKLNIIRDYEVVEKKLVYLPDELLGLVKCNNPKCITNNEPMKTLFKVIDKENVTLQCHYCEMKTKKEDIVLI
Sample Types
Isolate
4.3%
Metagenome
95.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.8%
Kalotermitidae
24.6%
Unclassified
12.3%
Blattidae
10.5%
Rhinotermitidae
5.3%
Termopsidae
5.3%
Passalidae
3.5%
Hodotermitidae
1.8%
Taxonomy
Archaea
0
Bacteria
217
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 2 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 7 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 8 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 16 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 20 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 27 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 28 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 29 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 30 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 31 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 34 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 35 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 36 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 37 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 38 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 39 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 40 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 41 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 42 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 43 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 44 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 45 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 46 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 47 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 48 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 49 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 50 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 51 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 52 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 53 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 54 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 55 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 56 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 57 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 58 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_113517 | 3300042612 | Bacteria | 11099 |
| 2 | Ga0466700_082826 | 3300042600 | Bacteria | 16628 |
| 3 | Ga0466707_260623 | 3300042601 | Bacteria | 26104 |
| 4 | Ga0466713_070966 | 3300042602 | Bacteria | 44045 |
| 5 | Ga0466717_100603 | 3300042604 | Bacteria | 1626 |
| 6 | Ga0466717_308155 | 3300042604 | Bacteria | 1443 |
| 7 | Ga0466719_066899 | 3300042606 | Bacteria | 15937 |
| 8 | Ga0466719_215929 | 3300042606 | Bacteria | 11551 |
| 9 | Ga0466719_269377 | 3300042606 | Bacteria | 4512 |
| 10 | Ga0123357_10004974 | 3300009784 | Bacteria | 15783 |
| 11 | Ga0123357_10338032 | 3300009784 | Unclassified | 1460 |
| 12 | Ga0123356_10196738 | 3300010049 | Bacteria | 2052 |
| 13 | Ga0123354_10000991 | 3300010882 | Bacteria | 32314 |
| 14 | Ga0123354_10009196 | 3300010882 | Bacteria | 15096 |
| 15 | Ga0466711_036516 | 3300042615 | Bacteria | 2837 |
| 16 | Ga0466711_386510 | 3300042615 | Bacteria | 4599 |
| 17 | Ga0466715_642871 | 3300042616 | Bacteria | 1412 |
| 18 | Ga0466723_068728 | 3300042618 | Bacteria | 7140 |
| 19 | Ga0466723_149228 | 3300042618 | Bacteria | 8202 |
| 20 | Ga0466726_373645 | 3300042619 | Bacteria | 2297 |
| 21 | Ga0466726_449784 | 3300042619 | Bacteria | 1827 |
| 22 | Ga0466690_017646 | 3300042590 | Bacteria | 34395 |
| 23 | Ga0466692_068023 | 3300042591 | Bacteria | 3007 |
| 24 | Ga0466692_073426 | 3300042591 | Bacteria | 43614 |
| 25 | Ga0466692_157631 | 3300042591 | Bacteria | 42163 |
| 26 | Ga0466692_164994 | 3300042591 | Bacteria | 1088 |
| 27 | Ga0466691_121957 | 3300042593 | Bacteria | 29225 |
| 28 | Ga0466696_198606 | 3300042596 | Bacteria | 1052 |
| 29 | Ga0466696_339334 | 3300042596 | Bacteria | 1411 |
| 30 | Ga0466704_093070 | 3300042643 | Bacteria | 10098 |
| 31 | Ga0466704_177078 | 3300042643 | Bacteria | 55313 |
| 32 | Ga0466727_207748 | 3300042655 | Bacteria | 4836 |
| 33 | JGI24702J35022_10267770 | 3300002462 | Bacteria | 999 |
| 34 | Ga0466705_140360 | 3300042612 | Bacteria | 13000 |
| 35 | Ga0466701_053585 | 3300042598 | Bacteria | 10241 |
| 36 | Ga0466707_228829 | 3300042601 | Unclassified | 1121 |
| 37 | Ga0466713_031119 | 3300042602 | Bacteria | 1842 |
| 38 | Ga0466713_060620 | 3300042602 | Bacteria | 398690 |
| 39 | Ga0466716_208033 | 3300042605 | Bacteria | 6814 |
| 40 | Ga0466698_115517 | 3300042610 | Bacteria | 2440 |
| 41 | Ga0123357_10091755 | 3300009784 | Bacteria | 3954 |
| 42 | Ga0466711_182217 | 3300042615 | Bacteria | 7158 |
| 43 | Ga0466715_240109 | 3300042616 | Bacteria | 17583 |
| 44 | Ga0466693_330855 | 3300042592 | Bacteria | 1652 |
| 45 | Ga0466696_102858 | 3300042596 | Bacteria | 1673 |
| 46 | Ga0466696_135989 | 3300042596 | Bacteria | 2130 |
| 47 | Ga0466703_035653 | 3300042636 | Bacteria | 19648 |
| 48 | Ga0466703_381243 | 3300042636 | Bacteria | 2335 |
| 49 | Ga0466704_465446 | 3300042643 | Bacteria | 11294 |
| 50 | Ga0466709_330887 | 3300042648 | Bacteria | 11774 |
| 51 | Ga0466709_365428 | 3300042648 | Bacteria | 8404 |
| 52 | Ga0466727_259399 | 3300042655 | Bacteria | 1732 |
| 53 | 2227660720 | 2225789004 | Bacteria | 10549 |
| 54 | Ga0068305_10835917 | 3300005083 | Bacteria | 771 |
| 55 | Ga0072941_1598145 | 3300005201 | Bacteria | 1718 |
| 56 | Ga0466705_022136 | 3300042612 | Bacteria | 7133 |
| 57 | Ga0466700_015099 | 3300042600 | Bacteria | 1549 |
| 58 | Ga0466700_376010 | 3300042600 | Bacteria | 38603 |
| 59 | Ga0466707_392739 | 3300042601 | Bacteria | 7555 |
| 60 | Ga0466713_077301 | 3300042602 | Bacteria | 4921 |
| 61 | Ga0466716_024785 | 3300042605 | Bacteria | 34126 |
| 62 | Ga0466716_051729 | 3300042605 | Bacteria | 13840 |
| 63 | Ga0466716_224350 | 3300042605 | Bacteria | 1799 |
| 64 | Ga0466716_283682 | 3300042605 | Bacteria | 3559 |
| 65 | Ga0466719_117183 | 3300042606 | Bacteria | 13535 |
| 66 | Ga0466722_041401 | 3300042609 | Bacteria | 3947 |
| 67 | Ga0123357_10296565 | 3300009784 | Unclassified | 1641 |
| 68 | Ga0123357_10377865 | 3300009784 | Unclassified | 1319 |
| 69 | Ga0123353_13085142 | 3300010167 | Bacteria | 537 |
| 70 | Ga0466711_458411 | 3300042615 | Bacteria | 8926 |
| 71 | Ga0466723_290087 | 3300042618 | Bacteria | 15581 |
| 72 | Ga0466690_009729 | 3300042590 | Bacteria | 4877 |
| 73 | Ga0466690_260239 | 3300042590 | Bacteria | 21247 |
| 74 | Ga0466692_182105 | 3300042591 | Bacteria | 3438 |
| 75 | Ga0466692_198726 | 3300042591 | Bacteria | 9425 |
| 76 | Ga0466693_077763 | 3300042592 | Bacteria | 1390 |
| 77 | Ga0466691_035615 | 3300042593 | Bacteria | 6377 |
| 78 | Ga0466691_123119 | 3300042593 | Bacteria | 5139 |
| 79 | Ga0466729_263389 | 3300042621 | Bacteria | 2403 |
| 80 | Ga0466734_130378 | 3300042623 | Unclassified | 1471 |
| 81 | Ga0466735_105782 | 3300042624 | Bacteria | 5274 |
| 82 | Ga0466735_111456 | 3300042624 | Bacteria | 7365 |
| 83 | Ga0466730_085559 | 3300042625 | Bacteria | 6436 |
| 84 | Ga0466703_038209 | 3300042636 | Bacteria | 5328 |
| 85 | Ga0466703_119757 | 3300042636 | Bacteria | 2152 |
| 86 | Ga0466704_181382 | 3300042643 | Bacteria | 6518 |
| 87 | Ga0466724_42932 | 3300042649 | Bacteria | 1209 |
| 88 | Ga0466708_176178 | 3300042652 | Bacteria | 4728 |
| 89 | Ga0466725_318308 | 3300042654 | Bacteria | 23406 |
| 90 | 2227476031 | 2225789004 | Unclassified | 4640 |
| 91 | IMNBL1DRAFT_c0013619 | 3300000062 | Bacteria | 3635 |
| 92 | JGI24702J35022_10707560 | 3300002462 | Bacteria | 626 |
| 93 | JGI24705J35276_12237825 | 3300002504 | Bacteria | 13403 |
| 94 | Ga0072941_1040185 | 3300005201 | Bacteria | 2126 |
| 95 | Ga0466701_069757 | 3300042598 | Bacteria | 1047 |
| 96 | Ga0466706_062130 | 3300042599 | Bacteria | 2382 |
| 97 | Ga0466707_215386 | 3300042601 | Bacteria | 1762 |
| 98 | Ga0466707_284882 | 3300042601 | Bacteria | 17288 |
| 99 | Ga0466713_068672 | 3300042602 | Bacteria | 133468 |
| 100 | Ga0466713_156185 | 3300042602 | Bacteria | 14156 |
| 101 | Ga0466716_171810 | 3300042605 | Bacteria | 8024 |
| 102 | Ga0466722_048454 | 3300042609 | Bacteria | 30141 |
| 103 | Ga0466722_199617 | 3300042609 | Unclassified | 2902 |
| 104 | Ga0123353_11040362 | 3300010167 | Bacteria | 1095 |
| 105 | Ga0123353_11929042 | 3300010167 | Bacteria | 727 |
| 106 | Ga0123354_10031878 | 3300010882 | Bacteria | 8267 |
| 107 | Ga0123354_10412438 | 3300010882 | Unclassified | 1131 |
| 108 | Ga0466715_024209 | 3300042616 | Bacteria | 19665 |
| 109 | Ga0466715_087491 | 3300042616 | Bacteria | 3991 |
| 110 | Ga0466715_364861 | 3300042616 | Bacteria | 4999 |
| 111 | Ga0466715_581132 | 3300042616 | Bacteria | 3436 |
| 112 | Ga0466723_036926 | 3300042618 | Bacteria | 32420 |
| 113 | Ga0466726_075338 | 3300042619 | Bacteria | 1420 |
| 114 | Ga0466728_410478 | 3300042620 | Bacteria | 6378 |
| 115 | Ga0466729_030230 | 3300042621 | Bacteria | 14951 |
| 116 | Ga0466692_009870 | 3300042591 | Bacteria | 9153 |
| 117 | Ga0466696_009779 | 3300042596 | Unclassified | 5541 |
| 118 | Ga0466696_213083 | 3300042596 | Bacteria | 6950 |
| 119 | Ga0466735_030593 | 3300042624 | Bacteria | 2844 |
| 120 | Ga0466735_128773 | 3300042624 | Bacteria | 5982 |
| 121 | Ga0466730_055699 | 3300042625 | Bacteria | 1673 |
| 122 | Ga0466703_277361 | 3300042636 | Bacteria | 17479 |
| 123 | Ga0466704_060157 | 3300042643 | Bacteria | 6034 |
| 124 | Ga0466704_104989 | 3300042643 | Bacteria | 11862 |
| 125 | Ga0466709_033772 | 3300042648 | Bacteria | 16857 |
| 126 | Ga0466709_125172 | 3300042648 | Bacteria | 4891 |
| 127 | 2227155799 | 2225789004 | Unclassified | 8465 |
| 128 | IMNBL1DRAFT_c0019805 | 3300000062 | Bacteria | 2745 |
| 129 | JGI24699J35502_11133775 | 3300002509 | Bacteria | 15393 |
| 130 | Ga0072940_1321641 | 3300005200 | Bacteria | 1810 |
| 131 | Ga0466705_111242 | 3300042612 | Bacteria | 2519 |
| 132 | Ga0466713_071986 | 3300042602 | Bacteria | 4982 |
| 133 | Ga0466722_163940 | 3300042609 | Bacteria | 1009 |
| 134 | Ga0123357_10022035 | 3300009784 | Bacteria | 8536 |
| 135 | Ga0123354_10766767 | 3300010882 | Unclassified | 657 |
| 136 | Ga0466711_031881 | 3300042615 | Bacteria | 12261 |
| 137 | Ga0466729_031103 | 3300042621 | Bacteria | 19143 |
| 138 | Ga0466690_070600 | 3300042590 | Bacteria | 2905 |
| 139 | Ga0466703_120630 | 3300042636 | Bacteria | 1928 |
| 140 | Ga0466703_313237 | 3300042636 | Bacteria | 1124 |
| 141 | Ga0466704_575307 | 3300042643 | Bacteria | 16371 |
| 142 | Ga0466709_026003 | 3300042648 | Bacteria | 3711 |
| 143 | IMNBL1DRAFT_c0078086 | 3300000062 | Bacteria | 935 |
| 144 | JGI24699J35502_11134177 | 3300002509 | Bacteria | 45536 |
| 145 | Ga0068305_10055507 | 3300005083 | Bacteria | 8481 |
| 146 | Ga0072941_1511077 | 3300005201 | Bacteria | 1611 |
| 147 | Ga0466733_106246 | 3300042659 | Bacteria | 308825 |
| 148 | Ga0466707_010922 | 3300042601 | Bacteria | 4134 |
| 149 | Ga0466707_110553 | 3300042601 | Bacteria | 8536 |
| 150 | Ga0466713_152634 | 3300042602 | Bacteria | 19458 |
| 151 | Ga0466716_207145 | 3300042605 | Bacteria | 17441 |
| 152 | Ga0466722_201619 | 3300042609 | Bacteria | 1170 |
| 153 | Ga0123357_10405571 | 3300009784 | Bacteria | 1235 |
| 154 | Ga0123357_10975909 | 3300009784 | Unclassified | 532 |
| 155 | Ga0466715_120257 | 3300042616 | Bacteria | 34712 |
| 156 | Ga0466715_465080 | 3300042616 | Bacteria | 29846 |
| 157 | Ga0466723_042874 | 3300042618 | Bacteria | 5321 |
| 158 | Ga0466726_086240 | 3300042619 | Bacteria | 21431 |
| 159 | Ga0466690_046822 | 3300042590 | Bacteria | 24937 |
| 160 | Ga0466690_059913 | 3300042590 | Bacteria | 43148 |
| 161 | Ga0466696_254351 | 3300042596 | Bacteria | 1668 |
| 162 | Ga0466727_179063 | 3300042655 | Bacteria | 8325 |
| 163 | 2227492984 | 2225789004 | Bacteria | 4026 |
| 164 | IMNBL1DRAFT_c0002265 | 3300000062 | Bacteria | 13543 |
| 165 | JGI24702J35022_10051904 | 3300002462 | Bacteria | 2185 |
| 166 | JGI24696J40584_12959126 | 3300002834 | Bacteria | 4740 |
| 167 | Ga0466697_226135 | 3300042611 | Bacteria | 3813 |
| 168 | Ga0466705_176520 | 3300042612 | Bacteria | 1313 |
| 169 | Ga0466707_160250 | 3300042601 | Bacteria | 6506 |
| 170 | Ga0466713_033740 | 3300042602 | Bacteria | 18936 |
| 171 | Ga0466719_564904 | 3300042606 | Bacteria | 3348 |
| 172 | Ga0466722_180420 | 3300042609 | Bacteria | 17585 |
| 173 | Ga0123357_10018382 | 3300009784 | Bacteria | 9291 |
| 174 | Ga0123357_10088198 | 3300009784 | Bacteria | 4055 |
| 175 | Ga0123354_10881472 | 3300010882 | Bacteria | 590 |
| 176 | Ga0466705_518890 | 3300042612 | Bacteria | 2172 |
| 177 | Ga0466715_157292 | 3300042616 | Bacteria | 5418 |
| 178 | Ga0466690_166867 | 3300042590 | Bacteria | 3284 |
| 179 | Ga0466691_099569 | 3300042593 | Bacteria | 2821 |
| 180 | Ga0466696_074655 | 3300042596 | Bacteria | 12961 |
| 181 | Ga0466696_150427 | 3300042596 | Bacteria | 2577 |
| 182 | Ga0466729_222218 | 3300042621 | Bacteria | 3926 |
| 183 | Ga0466734_134691 | 3300042623 | Bacteria | 2316 |
| 184 | Ga0466704_320398 | 3300042643 | Bacteria | 5525 |
| 185 | Ga0466704_397285 | 3300042643 | Bacteria | 2842 |
| 186 | Ga0466709_193369 | 3300042648 | Bacteria | 7409 |
| 187 | Ga0466708_307050 | 3300042652 | Bacteria | 51768 |
| 188 | 2227512193 | 2225789004 | Bacteria | 695 |
| 189 | 2227566236 | 2225789004 | Unclassified | 546 |
| 190 | IMNBL1DRAFT_c0019993 | 3300000062 | Bacteria | 2725 |
| 191 | JGI24702J35022_10016991 | 3300002462 | Bacteria | 3982 |
| 192 | JGI24705J35276_11622400 | 3300002504 | Bacteria | 600 |
| 193 | JGI24699J35502_11134209 | 3300002509 | Bacteria | 59622 |
| 194 | JGI24696J40584_12458839 | 3300002834 | Bacteria | 579 |
| 195 | Ga0466733_204405 | 3300042659 | Bacteria | 1438 |
| 196 | Ga0466707_338702 | 3300042601 | Bacteria | 5078 |
| 197 | Ga0466719_339505 | 3300042606 | Bacteria | 1359 |
| 198 | Ga0466721_337208 | 3300042608 | Bacteria | 1086 |
| 199 | Ga0466722_001372 | 3300042609 | Bacteria | 7070 |
| 200 | Ga0466722_017922 | 3300042609 | Bacteria | 50732 |
| 201 | Ga0123357_10520182 | 3300009784 | Unclassified | 973 |
| 202 | Ga0123354_10007876 | 3300010882 | Bacteria | 16139 |
| 203 | Ga0466705_403370 | 3300042612 | Bacteria | 2152 |
| 204 | Ga0466711_282831 | 3300042615 | Bacteria | 4772 |
| 205 | Ga0466711_437955 | 3300042615 | Bacteria | 1933 |
| 206 | Ga0466715_197333 | 3300042616 | Bacteria | 6380 |
| 207 | Ga0466715_381051 | 3300042616 | Bacteria | 5747 |
| 208 | Ga0466715_476140 | 3300042616 | Bacteria | 19389 |
| 209 | Ga0466726_409097 | 3300042619 | Bacteria | 1197 |
| 210 | Ga0466728_443271 | 3300042620 | Bacteria | 1678 |
| 211 | Ga0466729_001132 | 3300042621 | Bacteria | 2119 |
| 212 | Ga0466690_373916 | 3300042590 | Bacteria | 40566 |
| 213 | Ga0466693_181997 | 3300042592 | Bacteria | 1823 |
| 214 | Ga0466735_109035 | 3300042624 | Bacteria | 1267 |
| 215 | Ga0466735_203966 | 3300042624 | Bacteria | 3031 |
| 216 | Ga0466704_378984 | 3300042643 | Bacteria | 9005 |
| 217 | Ga0466727_010403 | 3300042655 | Bacteria | 6631 |
| 218 | Ga0466727_263304 | 3300042655 | Unclassified | 3874 |
| 219 | Ga0466727_282938 | 3300042655 | Bacteria | 7344 |
| 220 | IMNBL1DRAFT_c0001988 | 3300000062 | Bacteria | 14716 |
| 221 | IMNBL1DRAFT_c0013887 | 3300000062 | Bacteria | 3586 |
| 222 | JGI24702J35022_10001539 | 3300002462 | Bacteria | 14306 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.