Protein Family IF08790
Metagenome
Isolate
227
Members
69
Samples
204
Scaffolds
153.09
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_108937|Ga0466735_108937_502_1089
- Length
- 178 aa
- Sequence
- VDIVPPVNYEKPDWKNIWILYTKTNDTMKQMENLTLLGNKTEYKQDYSPEVLETFINKHPENDYWVRFNCPEFTSLCPITGQPDFATILIDYIPDIKMVESKSLKLYLFSFRNHGAFHEDCVNLIMKDLIRLMEPKYIEVTGIFTPRGGISIHPYCNYGKPNTKYIELAETRLFSHNR
Sample Types
Isolate
10.1%
Metagenome
89.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
27.9%
Termitidae
26.5%
Kalotermitidae
20.6%
Unclassified
8.8%
Termopsidae
5.9%
Rhinotermitidae
5.9%
Passalidae
2.9%
Hodotermitidae
1.5%
Taxonomy
Archaea
0
Bacteria
222
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 2 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 3 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 13 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 14 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 15 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 16 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 20 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 21 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 22 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 23 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 26 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 27 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 28 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 29 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 30 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 31 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 32 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 33 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 34 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 35 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 36 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 37 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 38 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 39 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 40 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 41 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 42 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 43 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 44 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 45 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 46 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 47 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 48 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 49 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 50 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 51 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 52 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 53 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 54 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 55 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 56 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 57 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 58 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 59 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 60 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 61 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 62 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 63 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 64 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 65 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 66 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 67 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 68 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 69 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_400686 | 3300042656 | Bacteria | 2602 |
| 2 | Ga0466692_091478 | 3300042591 | Bacteria | 12306 |
| 3 | Ga0466696_058283 | 3300042596 | Bacteria | 42827 |
| 4 | Ga0466711_127370 | 3300042615 | Bacteria | 1855 |
| 5 | Ga0466711_300008 | 3300042615 | Bacteria | 5257 |
| 6 | Ga0466715_017999 | 3300042616 | Bacteria | 13486 |
| 7 | Ga0466728_327906 | 3300042620 | Bacteria | 21158 |
| 8 | Ga0466728_445923 | 3300042620 | Bacteria | 6392 |
| 9 | Ga0466728_446298 | 3300042620 | Bacteria | 1424 |
| 10 | Ga0466707_136670 | 3300042601 | Bacteria | 19737 |
| 11 | Ga0466707_152311 | 3300042601 | Bacteria | 2222 |
| 12 | Ga0466713_049375 | 3300042602 | Bacteria | 4752 |
| 13 | Ga0466713_064260 | 3300042602 | Bacteria | 6676 |
| 14 | Ga0466713_105824 | 3300042602 | Bacteria | 3590 |
| 15 | Ga0466719_018539 | 3300042606 | Bacteria | 11876 |
| 16 | Ga0466719_496783 | 3300042606 | Bacteria | 1730 |
| 17 | Ga0466722_084365 | 3300042609 | Bacteria | 2639 |
| 18 | Ga0123357_10047608 | 3300009784 | Bacteria | 5810 |
| 19 | Ga0123357_10143775 | 3300009784 | Bacteria | 2922 |
| 20 | Ga0123353_13095907 | 3300010167 | Bacteria | 536 |
| 21 | Ga0123354_10325730 | 3300010882 | Bacteria | 1409 |
| 22 | IMNBL1DRAFT_c0028125 | 3300000062 | Bacteria | 2103 |
| 23 | JGI24702J35022_10007447 | 3300002462 | Bacteria | 6274 |
| 24 | JGI24702J35022_10041347 | 3300002462 | Bacteria | 2457 |
| 25 | JGI24702J35022_10111615 | 3300002462 | Bacteria | 1503 |
| 26 | Ga0466734_171169 | 3300042623 | Bacteria | 1126 |
| 27 | Ga0466735_100956 | 3300042624 | Bacteria | 2839 |
| 28 | Ga0466735_128462 | 3300042624 | Bacteria | 1584 |
| 29 | Ga0466735_131352 | 3300042624 | Bacteria | 1624 |
| 30 | Ga0466735_224687 | 3300042624 | Bacteria | 7662 |
| 31 | Ga0466735_225199 | 3300042624 | Bacteria | 2300 |
| 32 | Ga0466703_128588 | 3300042636 | Bacteria | 10959 |
| 33 | Ga0466703_301480 | 3300042636 | Bacteria | 15147 |
| 34 | Ga0466704_041418 | 3300042643 | Bacteria | 6792 |
| 35 | Ga0466704_453229 | 3300042643 | Bacteria | 8194 |
| 36 | Ga0466709_014514 | 3300042648 | Bacteria | 492815 |
| 37 | Ga0466733_029144 | 3300042659 | Bacteria | 52547 |
| 38 | Ga0466711_142073 | 3300042615 | Bacteria | 14548 |
| 39 | Ga0466711_254374 | 3300042615 | Bacteria | 1533 |
| 40 | Ga0466715_267280 | 3300042616 | Bacteria | 22706 |
| 41 | Ga0466729_121092 | 3300042621 | Bacteria | 5518 |
| 42 | Ga0466706_181631 | 3300042599 | Bacteria | 41135 |
| 43 | Ga0466700_487118 | 3300042600 | Bacteria | 26008 |
| 44 | Ga0466707_326904 | 3300042601 | Bacteria | 1146 |
| 45 | Ga0466713_068672 | 3300042602 | Bacteria | 133468 |
| 46 | Ga0466716_519942 | 3300042605 | Bacteria | 9158 |
| 47 | Ga0466719_123680 | 3300042606 | Bacteria | 9051 |
| 48 | Ga0123357_10007753 | 3300009784 | Bacteria | 13326 |
| 49 | Ga0123357_10012779 | 3300009784 | Bacteria | 10843 |
| 50 | Ga0123356_10291574 | 3300010049 | Bacteria | 1732 |
| 51 | Ga0123353_10184286 | 3300010167 | Bacteria | 3302 |
| 52 | Ga0123353_10756336 | 3300010167 | Bacteria | 1351 |
| 53 | Ga0123354_10123479 | 3300010882 | Bacteria | 3324 |
| 54 | JGI24702J35022_10227336 | 3300002462 | Bacteria | 1078 |
| 55 | Ga0072941_1656232 | 3300005201 | Bacteria | 680 |
| 56 | Ga0466697_138146 | 3300042611 | Bacteria | 2073 |
| 57 | Ga0466729_252893 | 3300042621 | Bacteria | 6115 |
| 58 | Ga0466735_118341 | 3300042624 | Bacteria | 1620 |
| 59 | Ga0466703_052069 | 3300042636 | Bacteria | 9170 |
| 60 | Ga0466703_201599 | 3300042636 | Bacteria | 6326 |
| 61 | Ga0466703_232967 | 3300042636 | Bacteria | 5118 |
| 62 | Ga0466704_075296 | 3300042643 | Bacteria | 42602 |
| 63 | Ga0466704_206348 | 3300042643 | Bacteria | 1429 |
| 64 | Ga0466704_231510 | 3300042643 | Bacteria | 12191 |
| 65 | Ga0466691_146388 | 3300042593 | Unclassified | 1186 |
| 66 | Ga0466696_184100 | 3300042596 | Bacteria | 13785 |
| 67 | Ga0466715_062070 | 3300042616 | Bacteria | 39108 |
| 68 | Ga0466723_007845 | 3300042618 | Bacteria | 6757 |
| 69 | Ga0466701_064771 | 3300042598 | Bacteria | 1116 |
| 70 | Ga0466707_015621 | 3300042601 | Bacteria | 5163 |
| 71 | Ga0466707_241757 | 3300042601 | Bacteria | 6380 |
| 72 | Ga0466707_326775 | 3300042601 | Bacteria | 3900 |
| 73 | Ga0466713_066167 | 3300042602 | Bacteria | 11539 |
| 74 | Ga0466713_101312 | 3300042602 | Bacteria | 1579 |
| 75 | Ga0466719_346255 | 3300042606 | Bacteria | 7607 |
| 76 | Ga0466719_438475 | 3300042606 | Bacteria | 7127 |
| 77 | Ga0123357_10003895 | 3300009784 | Bacteria | 17318 |
| 78 | Ga0123357_10036374 | 3300009784 | Bacteria | 6699 |
| 79 | Ga0123356_10236514 | 3300010049 | Bacteria | 1895 |
| 80 | Ga0123353_10788865 | 3300010167 | Bacteria | 1314 |
| 81 | Ga0123354_10044086 | 3300010882 | Bacteria | 6847 |
| 82 | IMNBL1DRAFT_c0019760 | 3300000062 | Bacteria | 2750 |
| 83 | JGI24702J35022_10017891 | 3300002462 | Bacteria | 3870 |
| 84 | JGI24705J35276_12173025 | 3300002504 | Bacteria | 1307 |
| 85 | JGI24705J35276_12223051 | 3300002504 | Bacteria | 2474 |
| 86 | JGI24696J40584_12837741 | 3300002834 | Bacteria | 946 |
| 87 | Ga0068302_10087765 | 3300005071 | Bacteria | 3859 |
| 88 | Ga0068305_10001238 | 3300005083 | Bacteria | 135699 |
| 89 | Ga0072941_1008065 | 3300005201 | Bacteria | 3067 |
| 90 | Ga0466705_191290 | 3300042612 | Bacteria | 5025 |
| 91 | Ga0466729_241719 | 3300042621 | Bacteria | 2233 |
| 92 | Ga0466734_102999 | 3300042623 | Bacteria | 1106 |
| 93 | Ga0466735_031521 | 3300042624 | Bacteria | 1877 |
| 94 | Ga0466735_142606 | 3300042624 | Bacteria | 1366 |
| 95 | Ga0466703_105913 | 3300042636 | Bacteria | 6404 |
| 96 | Ga0466704_458110 | 3300042643 | Bacteria | 4697 |
| 97 | Ga0466725_082871 | 3300042654 | Bacteria | 1822 |
| 98 | Ga0466725_459033 | 3300042654 | Bacteria | 15418 |
| 99 | Ga0466694_209431 | 3300042594 | Bacteria | 5138 |
| 100 | Ga0466696_066012 | 3300042596 | Bacteria | 1943 |
| 101 | Ga0466715_304964 | 3300042616 | Bacteria | 9019 |
| 102 | Ga0466726_113907 | 3300042619 | Bacteria | 7134 |
| 103 | Ga0466726_249155 | 3300042619 | Bacteria | 4100 |
| 104 | Ga0466726_254431 | 3300042619 | Bacteria | 13408 |
| 105 | Ga0466728_056085 | 3300042620 | Bacteria | 14847 |
| 106 | Ga0466706_241143 | 3300042599 | Bacteria | 24862 |
| 107 | Ga0466706_278830 | 3300042599 | Bacteria | 5531 |
| 108 | Ga0466707_383222 | 3300042601 | Bacteria | 43346 |
| 109 | Ga0466713_132836 | 3300042602 | Bacteria | 1046 |
| 110 | Ga0123357_10129843 | 3300009784 | Bacteria | 3142 |
| 111 | Ga0123357_10398893 | 3300009784 | Bacteria | 1254 |
| 112 | JGI24702J35022_10437727 | 3300002462 | Bacteria | 794 |
| 113 | JGI24705J35276_12124668 | 3300002504 | Bacteria | 1083 |
| 114 | Ga0068305_10085523 | 3300005083 | Bacteria | 7525 |
| 115 | Ga0466735_213590 | 3300042624 | Bacteria | 9573 |
| 116 | Ga0466704_127240 | 3300042643 | Bacteria | 5766 |
| 117 | Ga0466724_28439 | 3300042649 | Bacteria | 3085 |
| 118 | Ga0466691_197673 | 3300042593 | Bacteria | 2138 |
| 119 | Ga0466710_385010 | 3300042613 | Bacteria | 2200 |
| 120 | Ga0466701_053913 | 3300042598 | Bacteria | 7349 |
| 121 | Ga0466700_452082 | 3300042600 | Bacteria | 3905 |
| 122 | Ga0466719_040724 | 3300042606 | Bacteria | 6196 |
| 123 | Ga0466719_126763 | 3300042606 | Bacteria | 2090 |
| 124 | Ga0466719_473979 | 3300042606 | Bacteria | 11116 |
| 125 | Ga0466719_475113 | 3300042606 | Bacteria | 6093 |
| 126 | Ga0466722_022703 | 3300042609 | Bacteria | 1916 |
| 127 | Ga0466722_218513 | 3300042609 | Bacteria | 3015 |
| 128 | Ga0123357_10214522 | 3300009784 | Bacteria | 2152 |
| 129 | Ga0123356_12389191 | 3300010049 | Bacteria | 661 |
| 130 | Ga0123354_10000735 | 3300010882 | Bacteria | 35280 |
| 131 | Ga0123354_10080365 | 3300010882 | Bacteria | 4616 |
| 132 | Ga0072940_1539543 | 3300005200 | Bacteria | 1198 |
| 133 | Ga0466735_010750 | 3300042624 | Bacteria | 1997 |
| 134 | Ga0466727_271546 | 3300042655 | Bacteria | 9447 |
| 135 | Ga0466690_041954 | 3300042590 | Bacteria | 29614 |
| 136 | Ga0466690_338104 | 3300042590 | Bacteria | 9132 |
| 137 | Ga0466701_007929 | 3300042598 | Bacteria | 1817 |
| 138 | Ga0466711_111006 | 3300042615 | Bacteria | 9788 |
| 139 | Ga0466715_045974 | 3300042616 | Bacteria | 42084 |
| 140 | Ga0466715_173820 | 3300042616 | Bacteria | 65966 |
| 141 | Ga0466726_302010 | 3300042619 | Bacteria | 3055 |
| 142 | Ga0466728_247332 | 3300042620 | Bacteria | 5095 |
| 143 | Ga0466728_338284 | 3300042620 | Bacteria | 92891 |
| 144 | Ga0466706_189362 | 3300042599 | Bacteria | 4263 |
| 145 | Ga0466707_401757 | 3300042601 | Unclassified | 16266 |
| 146 | Ga0466716_161980 | 3300042605 | Bacteria | 6435 |
| 147 | Ga0123353_10121708 | 3300010167 | Bacteria | 4196 |
| 148 | Ga0123354_10001559 | 3300010882 | Bacteria | 28144 |
| 149 | Ga0466705_223014 | 3300042612 | Bacteria | 17196 |
| 150 | Ga0466704_254192 | 3300042643 | Bacteria | 18084 |
| 151 | Ga0466704_505708 | 3300042643 | Bacteria | 3580 |
| 152 | Ga0466727_064569 | 3300042655 | Bacteria | 47217 |
| 153 | Ga0466710_422754 | 3300042613 | Bacteria | 1120 |
| 154 | Ga0466711_037159 | 3300042615 | Bacteria | 9695 |
| 155 | Ga0466715_042244 | 3300042616 | Bacteria | 25310 |
| 156 | Ga0466715_435009 | 3300042616 | Bacteria | 1594 |
| 157 | Ga0466723_065546 | 3300042618 | Bacteria | 7651 |
| 158 | Ga0466700_156172 | 3300042600 | Bacteria | 109805 |
| 159 | Ga0466700_404495 | 3300042600 | Bacteria | 7869 |
| 160 | Ga0466707_059588 | 3300042601 | Bacteria | 8645 |
| 161 | Ga0466707_062556 | 3300042601 | Bacteria | 45654 |
| 162 | Ga0466713_123054 | 3300042602 | Bacteria | 24516 |
| 163 | Ga0123357_10052744 | 3300009784 | Bacteria | 5491 |
| 164 | Ga0123357_10726271 | 3300009784 | Bacteria | 701 |
| 165 | Ga0123356_11738553 | 3300010049 | Bacteria | 774 |
| 166 | Ga0123353_10152871 | 3300010167 | Unclassified | 3682 |
| 167 | 2227484648 | 2225789004 | Unclassified | 4303 |
| 168 | IMNBL1DRAFT_c0022160 | 3300000062 | Bacteria | 2521 |
| 169 | JGI24696J40584_12916164 | 3300002834 | Bacteria | 1301 |
| 170 | Ga0068302_10193391 | 3300005071 | Bacteria | 1552 |
| 171 | Ga0466697_136080 | 3300042611 | Bacteria | 1400 |
| 172 | Ga0466735_013699 | 3300042624 | Bacteria | 11147 |
| 173 | Ga0466735_078577 | 3300042624 | Bacteria | 1085 |
| 174 | Ga0466735_164593 | 3300042624 | Bacteria | 3213 |
| 175 | Ga0466735_224682 | 3300042624 | Bacteria | 5438 |
| 176 | Ga0466703_047486 | 3300042636 | Bacteria | 14786 |
| 177 | Ga0466704_115523 | 3300042643 | Bacteria | 13352 |
| 178 | Ga0466709_012403 | 3300042648 | Bacteria | 9849 |
| 179 | Ga0466709_345480 | 3300042648 | Bacteria | 40527 |
| 180 | Ga0466708_300459 | 3300042652 | Bacteria | 49937 |
| 181 | Ga0466727_302640 | 3300042655 | Bacteria | 10337 |
| 182 | Ga0466690_091300 | 3300042590 | Bacteria | 12561 |
| 183 | Ga0466691_070467 | 3300042593 | Bacteria | 27137 |
| 184 | Ga0466696_137130 | 3300042596 | Bacteria | 25007 |
| 185 | Ga0466729_152431 | 3300042621 | Bacteria | 9441 |
| 186 | Ga0466706_224673 | 3300042599 | Bacteria | 38412 |
| 187 | Ga0466707_021273 | 3300042601 | Bacteria | 1043 |
| 188 | Ga0466707_053552 | 3300042601 | Bacteria | 1700 |
| 189 | Ga0466713_122861 | 3300042602 | Bacteria | 17495 |
| 190 | Ga0466719_050874 | 3300042606 | Bacteria | 2830 |
| 191 | Ga0123357_10058856 | 3300009784 | Bacteria | 5157 |
| 192 | Ga0123357_10478050 | 3300009784 | Bacteria | 1055 |
| 193 | Ga0123356_10003380 | 3300010049 | Bacteria | 16739 |
| 194 | Ga0123356_10974916 | 3300010049 | Bacteria | 1018 |
| 195 | Ga0123356_12099599 | 3300010049 | Bacteria | 705 |
| 196 | 2227475205 | 2225789004 | Unclassified | 4680 |
| 197 | IMNBL1DRAFT_c0001998 | 3300000062 | Bacteria | 14672 |
| 198 | Ga0068305_10045447 | 3300005083 | Bacteria | 4939 |
| 199 | Ga0123357_10001719 | 3300009784 | Bacteria | 23618 |
| 200 | Ga0466735_108937 | 3300042624 | Bacteria | 2393 |
| 201 | Ga0466703_028432 | 3300042636 | Bacteria | 36646 |
| 202 | Ga0466703_381909 | 3300042636 | Bacteria | 7072 |
| 203 | Ga0466708_367106 | 3300042652 | Bacteria | 72455 |
| 204 | Ga0466727_184107 | 3300042655 | Bacteria | 5427 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF14489 | QueF | QueF-like protein | 83 | 162 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.