Protein Family IF08783
Metagenome
Isolate
281
Members
97
Samples
230
Scaffolds
322.53
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_093892|Ga0466735_093892_1568_2638
- Length
- 356 aa
- Sequence
- MKNGIFSRKNCIILINLLHLLIEFDNFNNIHFNKTIMEKSYVIGIDIGGTNSVFGVVDARGTILYSDSIKTSLYSEIDKYVDALSVGLDGVIEKAGGKSTIKGIGVGAPNGNYYTGCIDFAPNLPWRGKIPLAQLINDKTGLPVTLTNDANAAAIGEMTYGVARGMKDFIVITLGTGVGSGIVVGGNLVYGHDGFAGELGHVIVRRENGRLCGCGRHGCLEAYTSATGVARTARELLVSRTEKSLLRDIDAELITSKDVYDAAVKGDKLSLEIFEKTGTILGEAFADFIAFSSPEAIILFGGLARSGDLIMEPIQRALDENVLKVFAGKTKLLFSQLKESDAAVLGASALGWEVKG
Sample Types
Isolate
18.1%
Metagenome
81.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
36.1%
Termitidae
18.6%
Kalotermitidae
14.4%
Unclassified
13.4%
Rhinotermitidae
6.2%
Termopsidae
3.1%
Passalidae
3.1%
Hydrophilidae
2.1%
Hodotermitidae
1.0%
Tenebrionidae
1.0%
Culicidae
1.0%
Taxonomy
Archaea
0
Bacteria
273
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 2 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 3 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 4 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 5 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 6 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 7 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 8 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 9 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 10 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 11 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 12 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 13 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 14 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 15 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 16 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 17 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 18 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 19 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 22 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 23 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 24 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 27 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 28 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 29 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 30 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 31 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 32 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 33 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 34 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 35 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 36 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 37 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 38 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 39 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 40 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 41 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 42 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 43 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 44 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 45 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 46 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 47 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 48 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 49 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 50 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 51 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 52 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 53 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 54 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 55 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 56 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 57 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 58 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 59 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 60 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 61 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 62 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 63 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 64 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 65 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 66 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 67 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 68 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 69 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 70 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 71 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 72 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 73 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 74 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 75 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 76 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 77 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 78 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 79 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 80 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 81 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 82 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 83 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 84 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 85 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 86 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 87 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 88 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 89 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 90 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 91 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 92 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 93 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 94 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 95 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 96 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 97 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_284863 | 3300042612 | Bacteria | 5252 |
| 2 | Ga0123354_10067742 | 3300010882 | Bacteria | 5196 |
| 3 | Ga0466690_040815 | 3300042590 | Bacteria | 27317 |
| 4 | Ga0466691_076597 | 3300042593 | Bacteria | 34769 |
| 5 | Ga0466691_092282 | 3300042593 | Bacteria | 2572 |
| 6 | Ga0466696_230105 | 3300042596 | Bacteria | 2115 |
| 7 | Ga0466696_432160 | 3300042596 | Bacteria | 11292 |
| 8 | Ga0466715_471063 | 3300042616 | Bacteria | 22550 |
| 9 | Ga0466726_052728 | 3300042619 | Bacteria | 10684 |
| 10 | Ga0466726_076133 | 3300042619 | Bacteria | 50177 |
| 11 | Ga0466726_201869 | 3300042619 | Bacteria | 2080 |
| 12 | Ga0466728_061024 | 3300042620 | Bacteria | 3387 |
| 13 | Ga0466728_167295 | 3300042620 | Bacteria | 8014 |
| 14 | Ga0466735_093892 | 3300042624 | Bacteria | 3733 |
| 15 | Ga0466703_002806 | 3300042636 | Bacteria | 1635 |
| 16 | Ga0466703_185216 | 3300042636 | Bacteria | 18948 |
| 17 | Ga0466704_526153 | 3300042643 | Bacteria | 1864 |
| 18 | Ga0466727_201511 | 3300042655 | Bacteria | 8832 |
| 19 | 2227541305 | 2225789004 | Unclassified | 15560 |
| 20 | JGI24696J40584_12935015 | 3300002834 | Bacteria | 1551 |
| 21 | Ga0466706_006892 | 3300042599 | Bacteria | 6984 |
| 22 | Ga0466706_053224 | 3300042599 | Bacteria | 2501 |
| 23 | Ga0466706_139780 | 3300042599 | Bacteria | 25325 |
| 24 | Ga0466707_099113 | 3300042601 | Bacteria | 4149 |
| 25 | Ga0466713_028040 | 3300042602 | Bacteria | 9090 |
| 26 | Ga0466713_100528 | 3300042602 | Bacteria | 510720 |
| 27 | Ga0466714_074091 | 3300042603 | Bacteria | 3989 |
| 28 | Ga0466714_096045 | 3300042603 | Bacteria | 19538 |
| 29 | Ga0466716_137156 | 3300042605 | Bacteria | 11738 |
| 30 | Ga0466716_238887 | 3300042605 | Bacteria | 28802 |
| 31 | Ga0466722_015662 | 3300042609 | Bacteria | 7177 |
| 32 | Ga0466733_165673 | 3300042659 | Bacteria | 9015 |
| 33 | Ga0123357_10194641 | 3300009784 | Bacteria | 2326 |
| 34 | Ga0466690_306403 | 3300042590 | Bacteria | 20840 |
| 35 | Ga0466696_170441 | 3300042596 | Unclassified | 5539 |
| 36 | Ga0466696_394022 | 3300042596 | Bacteria | 212291 |
| 37 | Ga0466711_077037 | 3300042615 | Bacteria | 10814 |
| 38 | Ga0466711_091753 | 3300042615 | Bacteria | 15220 |
| 39 | Ga0466715_158052 | 3300042616 | Bacteria | 6555 |
| 40 | Ga0466715_237164 | 3300042616 | Bacteria | 20763 |
| 41 | Ga0466715_327431 | 3300042616 | Bacteria | 11649 |
| 42 | Ga0466723_064404 | 3300042618 | Bacteria | 11296 |
| 43 | Ga0466726_093842 | 3300042619 | Bacteria | 1632 |
| 44 | Ga0466728_154482 | 3300042620 | Bacteria | 34843 |
| 45 | Ga0466728_180682 | 3300042620 | Bacteria | 7084 |
| 46 | Ga0466728_264238 | 3300042620 | Bacteria | 8155 |
| 47 | Ga0466734_077027 | 3300042623 | Bacteria | 4043 |
| 48 | Ga0466704_227992 | 3300042643 | Unclassified | 13276 |
| 49 | Ga0466704_277144 | 3300042643 | Bacteria | 3284 |
| 50 | Ga0466709_399168 | 3300042648 | Bacteria | 2359 |
| 51 | Ga0466708_214005 | 3300042652 | Bacteria | 21996 |
| 52 | Ga0466727_028152 | 3300042655 | Bacteria | 14252 |
| 53 | IMNBL1DRAFT_c0007168 | 3300000062 | Bacteria | 5922 |
| 54 | IMNBL1DRAFT_c0014412 | 3300000062 | Bacteria | 3491 |
| 55 | JGI24702J35022_10000539 | 3300002462 | Bacteria | 22829 |
| 56 | Ga0068305_10015691 | 3300005083 | Bacteria | 40812 |
| 57 | Ga0466706_060160 | 3300042599 | Bacteria | 4112 |
| 58 | Ga0466706_164369 | 3300042599 | Bacteria | 4337 |
| 59 | Ga0466707_042036 | 3300042601 | Bacteria | 5533 |
| 60 | Ga0466713_009611 | 3300042602 | Bacteria | 50770 |
| 61 | Ga0466714_109666 | 3300042603 | Bacteria | 2099 |
| 62 | Ga0466722_113613 | 3300042609 | Bacteria | 129604 |
| 63 | Ga0466705_155733 | 3300042612 | Bacteria | 30369 |
| 64 | Ga0123353_10522148 | 3300010167 | Bacteria | 1722 |
| 65 | Ga0466690_134124 | 3300042590 | Bacteria | 14927 |
| 66 | Ga0466690_207852 | 3300042590 | Bacteria | 22066 |
| 67 | Ga0466692_066865 | 3300042591 | Bacteria | 168349 |
| 68 | Ga0466692_090388 | 3300042591 | Bacteria | 9587 |
| 69 | Ga0466691_082186 | 3300042593 | Bacteria | 3837 |
| 70 | Ga0466691_112917 | 3300042593 | Bacteria | 16704 |
| 71 | Ga0466691_150356 | 3300042593 | Bacteria | 13013 |
| 72 | Ga0466695_400238 | 3300042595 | Bacteria | 3354 |
| 73 | Ga0466696_483865 | 3300042596 | Bacteria | 4945 |
| 74 | Ga0466715_152522 | 3300042616 | Bacteria | 3581 |
| 75 | Ga0466715_413814 | 3300042616 | Bacteria | 9845 |
| 76 | Ga0466723_008165 | 3300042618 | Bacteria | 2653 |
| 77 | Ga0466735_198286 | 3300042624 | Bacteria | 6893 |
| 78 | Ga0466704_182973 | 3300042643 | Bacteria | 4932 |
| 79 | Ga0466704_502513 | 3300042643 | Bacteria | 10794 |
| 80 | Ga0466704_554901 | 3300042643 | Bacteria | 24622 |
| 81 | Ga0466708_367106 | 3300042652 | Bacteria | 72455 |
| 82 | Ga0466727_250096 | 3300042655 | Bacteria | 9105 |
| 83 | 2227549636 | 2225789004 | Bacteria | 15057 |
| 84 | IMNBL1DRAFT_c0000136 | 3300000062 | Bacteria | 65757 |
| 85 | Ga0068305_10016449 | 3300005083 | Unclassified | 7735 |
| 86 | Ga0466707_125431 | 3300042601 | Bacteria | 10173 |
| 87 | Ga0466713_016556 | 3300042602 | Bacteria | 4146 |
| 88 | Ga0466713_047868 | 3300042602 | Bacteria | 11022 |
| 89 | Ga0466713_128443 | 3300042602 | Bacteria | 30120 |
| 90 | Ga0466713_146724 | 3300042602 | Bacteria | 5308 |
| 91 | Ga0466716_344224 | 3300042605 | Bacteria | 3086 |
| 92 | Ga0466719_377084 | 3300042606 | Bacteria | 3496 |
| 93 | Ga0466722_069271 | 3300042609 | Bacteria | 10768 |
| 94 | Ga0466722_178845 | 3300042609 | Bacteria | 79493 |
| 95 | Ga0466705_111736 | 3300042612 | Bacteria | 12747 |
| 96 | Ga0466705_333635 | 3300042612 | Bacteria | 3574 |
| 97 | Ga0466733_088610 | 3300042659 | Bacteria | 5318 |
| 98 | Ga0466690_066226 | 3300042590 | Bacteria | 16041 |
| 99 | Ga0466690_266095 | 3300042590 | Bacteria | 5906 |
| 100 | Ga0466692_173188 | 3300042591 | Bacteria | 49928 |
| 101 | Ga0466696_045091 | 3300042596 | Bacteria | 15483 |
| 102 | Ga0466710_435740 | 3300042613 | Bacteria | 1338 |
| 103 | Ga0466711_039155 | 3300042615 | Bacteria | 7544 |
| 104 | Ga0466723_059293 | 3300042618 | Bacteria | 11190 |
| 105 | Ga0466735_010350 | 3300042624 | Bacteria | 4302 |
| 106 | Ga0466703_018300 | 3300042636 | Bacteria | 15549 |
| 107 | Ga0466708_044096 | 3300042652 | Bacteria | 70438 |
| 108 | Ga0466727_103661 | 3300042655 | Bacteria | 10179 |
| 109 | JGI24702J35022_10065359 | 3300002462 | Bacteria | 1951 |
| 110 | Ga0466706_042414 | 3300042599 | Bacteria | 11971 |
| 111 | Ga0466706_070230 | 3300042599 | Bacteria | 4192 |
| 112 | Ga0466707_416730 | 3300042601 | Bacteria | 3484 |
| 113 | Ga0466714_012355 | 3300042603 | Bacteria | 1877 |
| 114 | Ga0466714_013813 | 3300042603 | Bacteria | 151010 |
| 115 | Ga0466721_212652 | 3300042608 | Bacteria | 16387 |
| 116 | Ga0466722_219556 | 3300042609 | Bacteria | 1889 |
| 117 | Ga0466705_258636 | 3300042612 | Bacteria | 8663 |
| 118 | Ga0466733_006538 | 3300042659 | Bacteria | 7062 |
| 119 | Ga0466733_038286 | 3300042659 | Bacteria | 266317 |
| 120 | Ga0466733_129143 | 3300042659 | Bacteria | 21646 |
| 121 | Ga0123353_10008646 | 3300010167 | Bacteria | 13935 |
| 122 | Ga0123354_10312194 | 3300010882 | Bacteria | 1466 |
| 123 | Ga0466690_386085 | 3300042590 | Bacteria | 20488 |
| 124 | Ga0466693_133705 | 3300042592 | Bacteria | 1571 |
| 125 | Ga0466696_097370 | 3300042596 | Bacteria | 12209 |
| 126 | Ga0466705_462315 | 3300042612 | Bacteria | 2831 |
| 127 | Ga0466711_041942 | 3300042615 | Bacteria | 8794 |
| 128 | Ga0466715_048528 | 3300042616 | Bacteria | 41779 |
| 129 | Ga0466715_055808 | 3300042616 | Bacteria | 10565 |
| 130 | Ga0466715_427106 | 3300042616 | Bacteria | 52396 |
| 131 | Ga0466726_347118 | 3300042619 | Bacteria | 10170 |
| 132 | Ga0466728_070909 | 3300042620 | Bacteria | 19692 |
| 133 | Ga0466729_099612 | 3300042621 | Bacteria | 24055 |
| 134 | Ga0466731_090176 | 3300042622 | Bacteria | 1387 |
| 135 | Ga0466708_114192 | 3300042652 | Bacteria | 2806 |
| 136 | Ga0466727_220111 | 3300042655 | Bacteria | 43243 |
| 137 | 2227529891 | 2225789004 | Bacteria | 3174 |
| 138 | JGI24699J35502_11134227 | 3300002509 | Bacteria | 76542 |
| 139 | Ga0466706_202547 | 3300042599 | Bacteria | 1823 |
| 140 | Ga0466707_121272 | 3300042601 | Bacteria | 14434 |
| 141 | Ga0466713_047975 | 3300042602 | Bacteria | 7761 |
| 142 | Ga0466713_139646 | 3300042602 | Bacteria | 516516 |
| 143 | Ga0466716_286851 | 3300042605 | Bacteria | 11732 |
| 144 | Ga0466716_384664 | 3300042605 | Bacteria | 3229 |
| 145 | Ga0466716_536943 | 3300042605 | Bacteria | 9244 |
| 146 | Ga0466719_032833 | 3300042606 | Bacteria | 5307 |
| 147 | Ga0466719_263220 | 3300042606 | Bacteria | 12678 |
| 148 | Ga0123353_10000162 | 3300010167 | Bacteria | 85033 |
| 149 | Ga0123353_10346157 | 3300010167 | Unclassified | 2243 |
| 150 | Ga0466657_064955 | 3300042582 | Bacteria | 3403 |
| 151 | Ga0466692_140391 | 3300042591 | Bacteria | 136970 |
| 152 | Ga0466696_154148 | 3300042596 | Bacteria | 2762 |
| 153 | Ga0466696_404036 | 3300042596 | Bacteria | 3062 |
| 154 | Ga0466711_066658 | 3300042615 | Bacteria | 7473 |
| 155 | Ga0466711_255641 | 3300042615 | Bacteria | 5718 |
| 156 | Ga0466715_445208 | 3300042616 | Bacteria | 2589 |
| 157 | Ga0466723_025239 | 3300042618 | Bacteria | 67003 |
| 158 | Ga0466723_146997 | 3300042618 | Bacteria | 23442 |
| 159 | Ga0466735_089103 | 3300042624 | Bacteria | 2698 |
| 160 | Ga0466735_138394 | 3300042624 | Bacteria | 4797 |
| 161 | Ga0466730_088029 | 3300042625 | Bacteria | 3059 |
| 162 | Ga0466703_151997 | 3300042636 | Bacteria | 10621 |
| 163 | Ga0466703_165186 | 3300042636 | Bacteria | 7424 |
| 164 | Ga0466703_364369 | 3300042636 | Bacteria | 13478 |
| 165 | Ga0466704_126477 | 3300042643 | Bacteria | 9636 |
| 166 | Ga0466704_353113 | 3300042643 | Bacteria | 3323 |
| 167 | Ga0466709_387947 | 3300042648 | Bacteria | 2349 |
| 168 | Ga0466727_170943 | 3300042655 | Bacteria | 36421 |
| 169 | IMNBL1DRAFT_c0000838 | 3300000062 | Bacteria | 24143 |
| 170 | JGI24705J35276_12235290 | 3300002504 | Bacteria | 6369 |
| 171 | JGI24696J40584_12960159 | 3300002834 | Bacteria | 6454 |
| 172 | Ga0068305_10022870 | 3300005083 | Unclassified | 3846 |
| 173 | Ga0466706_011089 | 3300042599 | Bacteria | 3312 |
| 174 | Ga0466706_115643 | 3300042599 | Bacteria | 11447 |
| 175 | Ga0466713_154843 | 3300042602 | Bacteria | 19050 |
| 176 | Ga0466716_021658 | 3300042605 | Bacteria | 5504 |
| 177 | Ga0466716_050358 | 3300042605 | Bacteria | 8712 |
| 178 | Ga0466719_354092 | 3300042606 | Bacteria | 3843 |
| 179 | Ga0466719_478446 | 3300042606 | Bacteria | 11606 |
| 180 | Ga0466722_190554 | 3300042609 | Bacteria | 18850 |
| 181 | Ga0466705_297878 | 3300042612 | Bacteria | 9895 |
| 182 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 183 | Ga0123353_10028381 | 3300010167 | Bacteria | 8597 |
| 184 | Ga0160448_101472 | 3300012854 | Bacteria | 7528 |
| 185 | Ga0466657_222391 | 3300042582 | Bacteria | 4071 |
| 186 | Ga0466696_009032 | 3300042596 | Bacteria | 2510 |
| 187 | Ga0466710_292706 | 3300042613 | Unclassified | 3235 |
| 188 | Ga0466711_323861 | 3300042615 | Bacteria | 2937 |
| 189 | Ga0466715_119072 | 3300042616 | Bacteria | 9048 |
| 190 | Ga0466726_211588 | 3300042619 | Bacteria | 2623 |
| 191 | Ga0466703_186749 | 3300042636 | Unclassified | 4180 |
| 192 | Ga0466703_243974 | 3300042636 | Bacteria | 11125 |
| 193 | Ga0466703_374219 | 3300042636 | Bacteria | 24808 |
| 194 | Ga0466709_064284 | 3300042648 | Bacteria | 13198 |
| 195 | Ga0466727_192333 | 3300042655 | Bacteria | 7094 |
| 196 | IMNBGM34_c007955 | 3300000036 | Bacteria | 1359 |
| 197 | IMNBL1DRAFT_c0001182 | 3300000062 | Bacteria | 19907 |
| 198 | IMNBL1DRAFT_c0028853 | 3300000062 | Bacteria | 2062 |
| 199 | JGI24702J35022_10064074 | 3300002462 | Bacteria | 1970 |
| 200 | Ga0466701_035983 | 3300042598 | Bacteria | 36269 |
| 201 | Ga0466706_129722 | 3300042599 | Bacteria | 9634 |
| 202 | Ga0466706_218716 | 3300042599 | Bacteria | 2577 |
| 203 | Ga0466707_174399 | 3300042601 | Bacteria | 9055 |
| 204 | Ga0466713_013757 | 3300042602 | Bacteria | 111029 |
| 205 | Ga0466713_037688 | 3300042602 | Bacteria | 8094 |
| 206 | Ga0466713_118645 | 3300042602 | Bacteria | 113373 |
| 207 | Ga0466716_095541 | 3300042605 | Bacteria | 62772 |
| 208 | Ga0466716_499732 | 3300042605 | Bacteria | 4133 |
| 209 | Ga0466722_121524 | 3300042609 | Bacteria | 1497 |
| 210 | Ga0466705_039673 | 3300042612 | Bacteria | 7371 |
| 211 | Ga0466733_216697 | 3300042659 | Bacteria | 189231 |
| 212 | Ga0123357_10166436 | 3300009784 | Bacteria | 2623 |
| 213 | Ga0466657_372707 | 3300042582 | Bacteria | 5356 |
| 214 | Ga0466696_101690 | 3300042596 | Bacteria | 1504 |
| 215 | Ga0466696_449766 | 3300042596 | Bacteria | 6002 |
| 216 | Ga0466711_184071 | 3300042615 | Bacteria | 34370 |
| 217 | Ga0466723_154978 | 3300042618 | Bacteria | 69722 |
| 218 | Ga0466728_404970 | 3300042620 | Bacteria | 46041 |
| 219 | Ga0466735_001520 | 3300042624 | Bacteria | 7941 |
| 220 | Ga0466735_224846 | 3300042624 | Bacteria | 6547 |
| 221 | Ga0466703_043230 | 3300042636 | Bacteria | 9803 |
| 222 | Ga0466704_055849 | 3300042643 | Bacteria | 53217 |
| 223 | Ga0466704_263576 | 3300042643 | Bacteria | 9057 |
| 224 | JGI24702J35022_10054552 | 3300002462 | Bacteria | 2132 |
| 225 | Ga0466706_016306 | 3300042599 | Bacteria | 2225 |
| 226 | Ga0466706_117781 | 3300042599 | Bacteria | 29621 |
| 227 | Ga0466707_055253 | 3300042601 | Bacteria | 7309 |
| 228 | Ga0466713_033308 | 3300042602 | Bacteria | 2287 |
| 229 | Ga0466719_282129 | 3300042606 | Bacteria | 2984 |
| 230 | Ga0466722_030811 | 3300042609 | Bacteria | 14557 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00480 | ROK | ROK family | 42 | 350 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.