Protein Family IF08780
Metagenome
Isolate
184
Members
51
Samples
167
Scaffolds
264.97
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_087586|Ga0466735_087586_16852_17829
- Length
- 325 aa
- Sequence
- VLQSPRSFVFSSNFSGFCLEENFKALRKTPINYKKVKSEKLPVFPVVSAFLIFCKDVKSQENEMNIIVCIKQVPNTTDVQIDPETGRLKREGVESVINSFDEYAIEEGVRIKEKTGGKVIVVTMGPPQAESVLREAISKGADEAVLVSDRAFGGADTLATSYALSSAIKFIGSYDIILCGQQASDGDTSQVGPEIAEMLNIPHVAYIKKIESIDNKSIKVKRMMEDGCDLIESPVPVLLVVAKEINTPRIVSLKGKMAAKKAVIKILNAADVGADTKRTGLNGSPTQVMKIFVPPQRIGGGEKFSGGAKEVAAALVKRLSESRII
Sample Types
Isolate
9.2%
Metagenome
90.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
32.7%
Kalotermitidae
28.6%
Termitidae
22.4%
Termopsidae
8.2%
Rhinotermitidae
4.1%
Stratiomyidae
2.0%
Hodotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
178
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 2 | 2820594669 | Unclassified Firmicutes Emb289P1bin61 | Isolate | Unclassified |
| 3 | 2820606014 | Unclassified Firmicutes Emb289P1bin49 | Isolate | Unclassified |
| 4 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2754412482 | Unclassified Elusimicrobia Emb289P3bin85 | Isolate | Unclassified |
| 12 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 15 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 16 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 17 | 2772190894 | Unclassified Elusimicrobia Th196P4_bin33 | Isolate | Unclassified |
| 18 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 19 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 20 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 21 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 22 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 23 | 2754412483 | Unclassified Elusimicrobia Lab288P4bin38 | Isolate | Unclassified |
| 24 | 2772190893 | Unclassified Elusimicrobia Nt197P4_bin29 | Isolate | Unclassified |
| 25 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 26 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 27 | 2772190892 | Unclassified Elusimicrobia Lab288P3_bin37 | Isolate | Unclassified |
| 28 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 29 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 30 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 31 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 32 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 33 | 2772190889 | Unclassified Elusimicrobia Cu122P5_bin43 | Isolate | Unclassified |
| 34 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 35 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 36 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 37 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 38 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 39 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 40 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 41 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 42 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 43 | 642555172 | Endomicrobium trichonymphae Rs-D17 | Isolate | Unclassified |
| 44 | 2772190891 | Unclassified Elusimicrobia Emb289P1_bin41 | Isolate | Unclassified |
| 45 | 2820101058 | Unclassified Proteobacteria Emb289P4bin76 | Isolate | Unclassified |
| 46 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 47 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 48 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 49 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 50 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 51 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_208486 | 3300042612 | Bacteria | 71494 |
| 2 | Ga0123353_10146791 | 3300010167 | Bacteria | 3771 |
| 3 | Ga0466705_425951 | 3300042612 | Bacteria | 15257 |
| 4 | Ga0466711_186685 | 3300042615 | Bacteria | 1514 |
| 5 | Ga0466711_463845 | 3300042615 | Bacteria | 3681 |
| 6 | Ga0466715_120323 | 3300042616 | Bacteria | 7127 |
| 7 | Ga0466715_169785 | 3300042616 | Bacteria | 8000 |
| 8 | Ga0466723_049362 | 3300042618 | Bacteria | 19199 |
| 9 | Ga0466723_278795 | 3300042618 | Bacteria | 2575 |
| 10 | Ga0466723_303898 | 3300042618 | Bacteria | 4615 |
| 11 | Ga0466729_079038 | 3300042621 | Bacteria | 9279 |
| 12 | Ga0466713_060774 | 3300042602 | Bacteria | 81565 |
| 13 | Ga0466719_031813 | 3300042606 | Bacteria | 13883 |
| 14 | Ga0466696_026426 | 3300042596 | Bacteria | 6455 |
| 15 | Ga0068302_10029347 | 3300005071 | Bacteria | 3368 |
| 16 | Ga0466735_230340 | 3300042624 | Bacteria | 8377 |
| 17 | Ga0466703_178972 | 3300042636 | Unclassified | 135766 |
| 18 | Ga0466704_370727 | 3300042643 | Bacteria | 76606 |
| 19 | Ga0123357_10053156 | 3300009784 | Bacteria | 5466 |
| 20 | Ga0123355_10470568 | 3300009826 | Bacteria | 1570 |
| 21 | Ga0123356_10012070 | 3300010049 | Bacteria | 8402 |
| 22 | Ga0123353_10094658 | 3300010167 | Bacteria | 4813 |
| 23 | Ga0123353_10120061 | 3300010167 | Bacteria | 4227 |
| 24 | Ga0123353_10192285 | 3300010167 | Bacteria | 3220 |
| 25 | Ga0466715_115775 | 3300042616 | Bacteria | 18132 |
| 26 | Ga0466715_292182 | 3300042616 | Bacteria | 14379 |
| 27 | Ga0466723_208657 | 3300042618 | Bacteria | 23133 |
| 28 | Ga0466726_065940 | 3300042619 | Bacteria | 154230 |
| 29 | Ga0466726_095576 | 3300042619 | Bacteria | 4446 |
| 30 | Ga0466726_345134 | 3300042619 | Bacteria | 52575 |
| 31 | Ga0466728_346008 | 3300042620 | Bacteria | 130078 |
| 32 | Ga0466707_129349 | 3300042601 | Bacteria | 13473 |
| 33 | Ga0466713_147898 | 3300042602 | Bacteria | 26906 |
| 34 | Ga0466714_079920 | 3300042603 | Bacteria | 2993 |
| 35 | Ga0466716_392696 | 3300042605 | Bacteria | 2192 |
| 36 | Ga0466690_373341 | 3300042590 | Bacteria | 47139 |
| 37 | Ga0466691_057730 | 3300042593 | Unclassified | 12235 |
| 38 | Ga0466696_408175 | 3300042596 | Bacteria | 3354 |
| 39 | Ga0068305_10036831 | 3300005083 | Bacteria | 9322 |
| 40 | Ga0068305_10202759 | 3300005083 | Bacteria | 8253 |
| 41 | Ga0466735_003031 | 3300042624 | Bacteria | 37320 |
| 42 | Ga0466735_003865 | 3300042624 | Bacteria | 7685 |
| 43 | Ga0466735_010050 | 3300042624 | Bacteria | 3399 |
| 44 | Ga0466735_087586 | 3300042624 | Bacteria | 19813 |
| 45 | Ga0466703_230149 | 3300042636 | Bacteria | 15709 |
| 46 | Ga0466704_040833 | 3300042643 | Bacteria | 26578 |
| 47 | Ga0466727_063582 | 3300042655 | Bacteria | 93834 |
| 48 | Ga0123355_10015406 | 3300009826 | Bacteria | 12009 |
| 49 | Ga0123353_10055139 | 3300010167 | Bacteria | 6357 |
| 50 | Ga0466711_260244 | 3300042615 | Bacteria | 1938 |
| 51 | Ga0466715_347031 | 3300042616 | Bacteria | 23088 |
| 52 | Ga0466715_623834 | 3300042616 | Bacteria | 48519 |
| 53 | Ga0466726_198922 | 3300042619 | Bacteria | 37462 |
| 54 | Ga0466729_126861 | 3300042621 | Bacteria | 19801 |
| 55 | Ga0466707_033592 | 3300042601 | Unclassified | 5259 |
| 56 | Ga0466719_010648 | 3300042606 | Bacteria | 9354 |
| 57 | Ga0466719_156200 | 3300042606 | Bacteria | 1607 |
| 58 | Ga0466690_010270 | 3300042590 | Bacteria | 16820 |
| 59 | Ga0466690_028961 | 3300042590 | Unclassified | 8394 |
| 60 | Ga0466690_171986 | 3300042590 | Bacteria | 14328 |
| 61 | JGI24702J35022_10016814 | 3300002462 | Bacteria | 4005 |
| 62 | Ga0068305_10000253 | 3300005083 | Bacteria | 49207 |
| 63 | Ga0466735_204994 | 3300042624 | Bacteria | 2768 |
| 64 | Ga0466703_332047 | 3300042636 | Bacteria | 12352 |
| 65 | Ga0466704_152306 | 3300042643 | Bacteria | 2060 |
| 66 | Ga0466708_122809 | 3300042652 | Bacteria | 31687 |
| 67 | Ga0466708_244307 | 3300042652 | Bacteria | 44981 |
| 68 | Ga0123353_10022539 | 3300010167 | Bacteria | 9501 |
| 69 | Ga0123353_10026787 | 3300010167 | Bacteria | 8813 |
| 70 | Ga0123353_10123149 | 3300010167 | Bacteria | 4168 |
| 71 | Ga0123353_10407062 | 3300010167 | Bacteria | 2022 |
| 72 | Ga0466711_200084 | 3300042615 | Bacteria | 13758 |
| 73 | Ga0466715_038833 | 3300042616 | Bacteria | 25519 |
| 74 | Ga0466715_301683 | 3300042616 | Bacteria | 6785 |
| 75 | Ga0466723_133842 | 3300042618 | Bacteria | 68745 |
| 76 | Ga0466723_259748 | 3300042618 | Bacteria | 40517 |
| 77 | Ga0466707_128815 | 3300042601 | Bacteria | 23027 |
| 78 | Ga0466713_043545 | 3300042602 | Bacteria | 11597 |
| 79 | Ga0466716_023046 | 3300042605 | Bacteria | 14254 |
| 80 | Ga0466690_365652 | 3300042590 | Bacteria | 25645 |
| 81 | Ga0466691_001985 | 3300042593 | Bacteria | 8464 |
| 82 | Ga0466691_130597 | 3300042593 | Bacteria | 5840 |
| 83 | Ga0466696_330331 | 3300042596 | Bacteria | 41193 |
| 84 | JGI24705J35276_12238775 | 3300002504 | Bacteria | 60537 |
| 85 | Ga0068305_10000184 | 3300005083 | Bacteria | 99663 |
| 86 | Ga0466735_005632 | 3300042624 | Bacteria | 21515 |
| 87 | Ga0466735_040512 | 3300042624 | Bacteria | 6065 |
| 88 | Ga0466735_178876 | 3300042624 | Bacteria | 3286 |
| 89 | Ga0466735_228091 | 3300042624 | Bacteria | 2766 |
| 90 | Ga0466708_327175 | 3300042652 | Bacteria | 21277 |
| 91 | Ga0123353_10189593 | 3300010167 | Bacteria | 3247 |
| 92 | Ga0123354_10032651 | 3300010882 | Bacteria | 8158 |
| 93 | Ga0466715_456889 | 3300042616 | Bacteria | 238254 |
| 94 | Ga0466728_151618 | 3300042620 | Bacteria | 58568 |
| 95 | Ga0466728_266089 | 3300042620 | Bacteria | 33161 |
| 96 | Ga0466713_044417 | 3300042602 | Bacteria | 52236 |
| 97 | Ga0466714_050833 | 3300042603 | Bacteria | 2412 |
| 98 | Ga0466714_114479 | 3300042603 | Bacteria | 31091 |
| 99 | Ga0466716_046009 | 3300042605 | Bacteria | 2619 |
| 100 | Ga0466690_360903 | 3300042590 | Bacteria | 14859 |
| 101 | Ga0466735_096523 | 3300042624 | Bacteria | 1404 |
| 102 | Ga0466735_124117 | 3300042624 | Bacteria | 3531 |
| 103 | Ga0466705_090949 | 3300042612 | Bacteria | 1186 |
| 104 | Ga0466711_246643 | 3300042615 | Bacteria | 90615 |
| 105 | Ga0466711_405813 | 3300042615 | Bacteria | 65237 |
| 106 | Ga0466715_371229 | 3300042616 | Bacteria | 2199 |
| 107 | Ga0466723_063534 | 3300042618 | Bacteria | 25679 |
| 108 | Ga0466726_122489 | 3300042619 | Bacteria | 4241 |
| 109 | Ga0466726_378689 | 3300042619 | Bacteria | 30171 |
| 110 | Ga0466729_051897 | 3300042621 | Bacteria | 6222 |
| 111 | Ga0466729_060112 | 3300042621 | Bacteria | 27940 |
| 112 | Ga0466706_074985 | 3300042599 | Bacteria | 164025 |
| 113 | Ga0466707_013650 | 3300042601 | Bacteria | 197174 |
| 114 | Ga0466707_272364 | 3300042601 | Bacteria | 2387 |
| 115 | Ga0466713_146478 | 3300042602 | Bacteria | 2092 |
| 116 | Ga0466716_420695 | 3300042605 | Bacteria | 6077 |
| 117 | Ga0466690_072909 | 3300042590 | Bacteria | 18807 |
| 118 | Ga0466692_119455 | 3300042591 | Bacteria | 2711 |
| 119 | Ga0466693_386318 | 3300042592 | Bacteria | 1655 |
| 120 | Ga0466691_097267 | 3300042593 | Bacteria | 33655 |
| 121 | Ga0068305_10000012 | 3300005083 | Bacteria | 51331 |
| 122 | Ga0068305_10000195 | 3300005083 | Bacteria | 118813 |
| 123 | Ga0068305_10004980 | 3300005083 | Bacteria | 28780 |
| 124 | Ga0123357_10000774 | 3300009784 | Bacteria | 32268 |
| 125 | Ga0466703_250320 | 3300042636 | Bacteria | 592480 |
| 126 | Ga0466705_293486 | 3300042612 | Bacteria | 2858 |
| 127 | Ga0123353_10314645 | 3300010167 | Bacteria | 2380 |
| 128 | Ga0466715_450036 | 3300042616 | Bacteria | 13732 |
| 129 | Ga0466723_201575 | 3300042618 | Bacteria | 22115 |
| 130 | Ga0466723_276603 | 3300042618 | Bacteria | 34293 |
| 131 | Ga0466726_313413 | 3300042619 | Bacteria | 2645 |
| 132 | Ga0466728_171975 | 3300042620 | Bacteria | 12155 |
| 133 | Ga0466696_037686 | 3300042596 | Bacteria | 2645 |
| 134 | Ga0105524_100363 | 3300007733 | Bacteria | 19574 |
| 135 | Ga0466735_136296 | 3300042624 | Bacteria | 3298 |
| 136 | Ga0466703_158285 | 3300042636 | Bacteria | 84792 |
| 137 | Ga0466704_440731 | 3300042643 | Unclassified | 36701 |
| 138 | Ga0466705_229695 | 3300042612 | Bacteria | 6517 |
| 139 | Ga0466705_257501 | 3300042612 | Bacteria | 57239 |
| 140 | Ga0123355_10047235 | 3300009826 | Bacteria | 7001 |
| 141 | Ga0123353_10540524 | 3300010167 | Bacteria | 1684 |
| 142 | Ga0466711_044341 | 3300042615 | Bacteria | 37002 |
| 143 | Ga0466711_050574 | 3300042615 | Bacteria | 4719 |
| 144 | Ga0466711_242882 | 3300042615 | Bacteria | 8718 |
| 145 | Ga0466711_322092 | 3300042615 | Bacteria | 1937 |
| 146 | Ga0466723_164565 | 3300042618 | Bacteria | 21152 |
| 147 | Ga0466726_037101 | 3300042619 | Bacteria | 6436 |
| 148 | Ga0466728_298051 | 3300042620 | Bacteria | 8122 |
| 149 | Ga0466706_031300 | 3300042599 | Bacteria | 209681 |
| 150 | Ga0466706_214601 | 3300042599 | Bacteria | 6886 |
| 151 | Ga0466706_241799 | 3300042599 | Bacteria | 2613 |
| 152 | Ga0466713_137895 | 3300042602 | Bacteria | 14895 |
| 153 | Ga0466717_272291 | 3300042604 | Bacteria | 2320 |
| 154 | Ga0466719_088050 | 3300042606 | Bacteria | 1553 |
| 155 | Ga0466719_527379 | 3300042606 | Bacteria | 121423 |
| 156 | Ga0466690_070306 | 3300042590 | Unclassified | 3022 |
| 157 | Ga0466693_207918 | 3300042592 | Bacteria | 4162 |
| 158 | Ga0466696_146852 | 3300042596 | Bacteria | 8794 |
| 159 | JGI24702J35022_10000888 | 3300002462 | Bacteria | 18542 |
| 160 | Ga0068302_10136485 | 3300005071 | Bacteria | 6819 |
| 161 | Ga0466735_023986 | 3300042624 | Bacteria | 3167 |
| 162 | Ga0466735_031928 | 3300042624 | Bacteria | 4118 |
| 163 | Ga0466735_062209 | 3300042624 | Bacteria | 6356 |
| 164 | Ga0466704_141147 | 3300042643 | Bacteria | 7672 |
| 165 | Ga0466709_160210 | 3300042648 | Bacteria | 15445 |
| 166 | Ga0466708_358501 | 3300042652 | Bacteria | 3361 |
| 167 | Ga0466727_006674 | 3300042655 | Bacteria | 59645 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01012 | ETF | Electron transfer flavoprotein domain | 87 | 271 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.