Protein Family IF08767
Metagenome
Isolate
141
Members
51
Samples
130
Scaffolds
399.74
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_072428|Ga0466735_072428_29439_30809
- Length
- 456 aa
- Sequence
- MVGIYLQKILAIIKKIDKLWRKSSEKYKNKITFIAILSFIGSVVKQQNLNQSKMAKRKTLMEQKRVYLDNSATTVVDSEVIKEMQPYFFAIYGNASSFHYFGRQAKIALDNARKKTAMLLNSSSEEIFFTGCGTESDNIAIFGILNAYGEKGHIITSKIEHHAVLYSCKHLEANGYEVTYLDVDEDGVVSVEDFKKAVKDNTLLVTIMHANNEVGSIQPIEKIAAELKKINRKRKKKIYFHTDAVQTAGKLYLDVKKLGIDLLAISAHKFNGPKGVGALYIKNGTNILPIAFGGHHENGIRPGTENIPYISGLAKALEISNSKIEEYNKHVFALREKLKEGILNTIPDVIINGSSNRTVSNILNASFNYIEGEALLLMLDMKGIAVSTGSACASGSSGPSHVLSAMGVNPITSQGAIRFSFGYHNTEEDVDYVLKVLPKVISSLRSMSPVWNQKNT
Sample Types
Isolate
7.8%
Metagenome
92.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
31.4%
Unclassified
27.5%
Kalotermitidae
27.5%
Termopsidae
7.8%
Rhinotermitidae
3.9%
Hodotermitidae
2.0%
Taxonomy
Archaea
1
Bacteria
126
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2754412482 | Unclassified Elusimicrobia Emb289P3bin85 | Isolate | Unclassified |
| 2 | 2820171952 | Unclassified Planctomycetes Th196P3bin88 | Isolate | Unclassified |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 5 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 6 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 7 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 8 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 9 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 10 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 11 | 2820205024 | Unclassified Planctomycetes Cu122P4bin3 | Isolate | Unclassified |
| 12 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 16 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 17 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 18 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 2820178484 | Unclassified Planctomycetes Th196P3bin110 | Isolate | Unclassified |
| 21 | 642555172 | Endomicrobium trichonymphae Rs-D17 | Isolate | Unclassified |
| 22 | 2772190894 | Unclassified Elusimicrobia Th196P4_bin33 | Isolate | Unclassified |
| 23 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 2754412483 | Unclassified Elusimicrobia Lab288P4bin38 | Isolate | Unclassified |
| 27 | 2820201435 | Unclassified Planctomycetes Cu122P5bin25 | Isolate | Unclassified |
| 28 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 29 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 30 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 31 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 32 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 33 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 34 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 35 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 36 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 37 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 38 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 39 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 40 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 41 | 2772190892 | Unclassified Elusimicrobia Lab288P3_bin37 | Isolate | Unclassified |
| 42 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 43 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 44 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 45 | 2772190891 | Unclassified Elusimicrobia Emb289P1_bin41 | Isolate | Unclassified |
| 46 | 2820180635 | Unclassified Planctomycetes Lab288P3bin24 | Isolate | Unclassified |
| 47 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 48 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 49 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 50 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 51 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10076414 | 3300010049 | Bacteria | 3156 |
| 2 | Ga0123353_10000622 | 3300010167 | Bacteria | 43414 |
| 3 | Ga0466692_184925 | 3300042591 | Bacteria | 6931 |
| 4 | Ga0466691_136766 | 3300042593 | Bacteria | 1878 |
| 5 | Ga0466694_055471 | 3300042594 | Bacteria | 1342 |
| 6 | Ga0466700_144792 | 3300042600 | Bacteria | 3554 |
| 7 | Ga0466700_228741 | 3300042600 | Bacteria | 4236 |
| 8 | Ga0466707_015911 | 3300042601 | Bacteria | 5133 |
| 9 | Ga0466707_070275 | 3300042601 | Bacteria | 3007 |
| 10 | Ga0466717_186991 | 3300042604 | Bacteria | 3381 |
| 11 | Ga0466716_000351 | 3300042605 | Bacteria | 1419 |
| 12 | Ga0466719_110047 | 3300042606 | Bacteria | 2780 |
| 13 | Ga0466698_323632 | 3300042610 | Bacteria | 8698 |
| 14 | Ga0466735_016225 | 3300042624 | Bacteria | 17417 |
| 15 | Ga0466704_306732 | 3300042643 | Bacteria | 7957 |
| 16 | Ga0466708_201570 | 3300042652 | Bacteria | 5216 |
| 17 | Ga0466711_065153 | 3300042615 | Bacteria | 7378 |
| 18 | Ga0466711_496480 | 3300042615 | Bacteria | 39663 |
| 19 | Ga0123356_10049178 | 3300010049 | Unclassified | 3925 |
| 20 | Ga0123356_10068494 | 3300010049 | Bacteria | 3325 |
| 21 | Ga0123353_10000583 | 3300010167 | Bacteria | 44559 |
| 22 | Ga0123353_10508828 | 3300010167 | Bacteria | 1752 |
| 23 | Ga0466690_266367 | 3300042590 | Unclassified | 1811 |
| 24 | Ga0466691_014514 | 3300042593 | Unclassified | 1878 |
| 25 | Ga0466706_019380 | 3300042599 | Bacteria | 325727 |
| 26 | Ga0466707_039748 | 3300042601 | Bacteria | 11754 |
| 27 | Ga0466714_005261 | 3300042603 | Bacteria | 19984 |
| 28 | Ga0068305_10000886 | 3300005083 | Bacteria | 103801 |
| 29 | Ga0466735_029396 | 3300042624 | Bacteria | 12755 |
| 30 | Ga0466735_039781 | 3300042624 | Bacteria | 11475 |
| 31 | Ga0466703_033478 | 3300042636 | Bacteria | 6660 |
| 32 | Ga0466704_095429 | 3300042643 | Bacteria | 32723 |
| 33 | Ga0466704_244076 | 3300042643 | Bacteria | 8715 |
| 34 | Ga0466704_420369 | 3300042643 | Bacteria | 3350 |
| 35 | Ga0466727_255871 | 3300042655 | Bacteria | 1953 |
| 36 | Ga0466711_270442 | 3300042615 | Bacteria | 79052 |
| 37 | Ga0466726_378994 | 3300042619 | Bacteria | 129768 |
| 38 | Ga0466728_454633 | 3300042620 | Bacteria | 31354 |
| 39 | Ga0466729_011567 | 3300042621 | Bacteria | 40528 |
| 40 | Ga0466729_106778 | 3300042621 | Bacteria | 3334 |
| 41 | Ga0123356_10131093 | 3300010049 | Bacteria | 2456 |
| 42 | Ga0123353_10172439 | 3300010167 | Bacteria | 3432 |
| 43 | Ga0415639_009210 | 3300038395 | Bacteria | 10528 |
| 44 | Ga0466706_029308 | 3300042599 | Bacteria | 1936 |
| 45 | Ga0466716_353646 | 3300042605 | Bacteria | 6995 |
| 46 | Ga0466719_127211 | 3300042606 | Bacteria | 279481 |
| 47 | Ga0466734_007446 | 3300042623 | Bacteria | 3268 |
| 48 | Ga0466735_072428 | 3300042624 | Bacteria | 37832 |
| 49 | Ga0466703_153390 | 3300042636 | Bacteria | 18790 |
| 50 | Ga0466704_224220 | 3300042643 | Bacteria | 8740 |
| 51 | Ga0466711_001984 | 3300042615 | Bacteria | 177943 |
| 52 | Ga0466726_249452 | 3300042619 | Bacteria | 4015 |
| 53 | Ga0466726_439489 | 3300042619 | Bacteria | 24596 |
| 54 | Ga0466729_057294 | 3300042621 | Unclassified | 3838 |
| 55 | Ga0466729_100968 | 3300042621 | Bacteria | 3751 |
| 56 | Ga0466729_125979 | 3300042621 | Bacteria | 12819 |
| 57 | Ga0123355_10000822 | 3300009826 | Bacteria | 42541 |
| 58 | Ga0123353_10000316 | 3300010167 | Bacteria | 59704 |
| 59 | Ga0123353_10016969 | 3300010167 | Bacteria | 10672 |
| 60 | Ga0123353_10025829 | 3300010167 | Unclassified | 8958 |
| 61 | Ga0466707_295106 | 3300042601 | Bacteria | 9466 |
| 62 | JGI24702J35022_10000214 | 3300002462 | Bacteria | 32197 |
| 63 | Ga0068302_10246553 | 3300005071 | Bacteria | 2535 |
| 64 | Ga0466727_146761 | 3300042655 | Bacteria | 1627 |
| 65 | Ga0466726_092873 | 3300042619 | Bacteria | 39334 |
| 66 | Ga0466726_249824 | 3300042619 | Archaea | 1851 |
| 67 | Ga0466705_100041 | 3300042612 | Bacteria | 4137 |
| 68 | Ga0123356_10015443 | 3300010049 | Unclassified | 7320 |
| 69 | Ga0123353_10270022 | 3300010167 | Bacteria | 2621 |
| 70 | Ga0466692_051642 | 3300042591 | Bacteria | 5106 |
| 71 | Ga0466696_267759 | 3300042596 | Unclassified | 15141 |
| 72 | Ga0466707_042381 | 3300042601 | Bacteria | 20569 |
| 73 | Ga0466713_128712 | 3300042602 | Bacteria | 12608 |
| 74 | Ga0466716_085544 | 3300042605 | Bacteria | 17970 |
| 75 | Ga0466716_346216 | 3300042605 | Bacteria | 4178 |
| 76 | Ga0466716_472635 | 3300042605 | Unclassified | 4765 |
| 77 | Ga0466719_473160 | 3300042606 | Bacteria | 7030 |
| 78 | Ga0466698_220452 | 3300042610 | Bacteria | 1248 |
| 79 | Ga0068302_10039338 | 3300005071 | Unclassified | 2034 |
| 80 | Ga0466711_161772 | 3300042615 | Bacteria | 3110 |
| 81 | Ga0466715_063937 | 3300042616 | Bacteria | 69304 |
| 82 | Ga0466715_111049 | 3300042616 | Unclassified | 10088 |
| 83 | Ga0466715_457561 | 3300042616 | Bacteria | 3298 |
| 84 | Ga0466718_000322 | 3300042617 | Bacteria | 24130 |
| 85 | Ga0466705_158297 | 3300042612 | Bacteria | 33941 |
| 86 | Ga0123353_10001611 | 3300010167 | Bacteria | 27817 |
| 87 | Ga0123353_10101540 | 3300010167 | Bacteria | 4637 |
| 88 | Ga0466690_141050 | 3300042590 | Bacteria | 22929 |
| 89 | Ga0466696_222800 | 3300042596 | Bacteria | 4170 |
| 90 | Ga0466707_175941 | 3300042601 | Bacteria | 5052 |
| 91 | Ga0466707_232660 | 3300042601 | Bacteria | 30117 |
| 92 | Ga0068305_10000004 | 3300005083 | Bacteria | 52322 |
| 93 | Ga0466729_256739 | 3300042621 | Bacteria | 2084 |
| 94 | Ga0466708_073321 | 3300042652 | Bacteria | 12359 |
| 95 | Ga0466711_234694 | 3300042615 | Bacteria | 52796 |
| 96 | Ga0466728_090296 | 3300042620 | Bacteria | 19091 |
| 97 | Ga0466690_359349 | 3300042590 | Bacteria | 12962 |
| 98 | Ga0466691_027651 | 3300042593 | Bacteria | 5816 |
| 99 | Ga0466707_307964 | 3300042601 | Bacteria | 56092 |
| 100 | Ga0466719_116654 | 3300042606 | Bacteria | 2829 |
| 101 | Ga0466719_350969 | 3300042606 | Bacteria | 16465 |
| 102 | Ga0068305_10001964 | 3300005083 | Bacteria | 66110 |
| 103 | Ga0466731_119994 | 3300042622 | Bacteria | 2780 |
| 104 | Ga0466735_097271 | 3300042624 | Bacteria | 11796 |
| 105 | Ga0466703_030596 | 3300042636 | Unclassified | 50415 |
| 106 | Ga0466708_249803 | 3300042652 | Bacteria | 1635 |
| 107 | Ga0466711_446261 | 3300042615 | Bacteria | 4222 |
| 108 | Ga0466715_328438 | 3300042616 | Bacteria | 5655 |
| 109 | Ga0466723_343684 | 3300042618 | Bacteria | 61643 |
| 110 | Ga0466726_387678 | 3300042619 | Bacteria | 397429 |
| 111 | Ga0466729_004750 | 3300042621 | Bacteria | 61034 |
| 112 | Ga0123355_10220300 | 3300009826 | Unclassified | 2730 |
| 113 | Ga0123356_10032258 | 3300010049 | Bacteria | 4901 |
| 114 | Ga0466690_268040 | 3300042590 | Unclassified | 1298 |
| 115 | Ga0466693_329699 | 3300042592 | Bacteria | 1204 |
| 116 | Ga0466695_149844 | 3300042595 | Bacteria | 2337 |
| 117 | Ga0466696_207477 | 3300042596 | Bacteria | 11495 |
| 118 | Ga0466706_006636 | 3300042599 | Bacteria | 217881 |
| 119 | Ga0466707_216666 | 3300042601 | Bacteria | 5007 |
| 120 | Ga0466713_140430 | 3300042602 | Bacteria | 4966 |
| 121 | Ga0466719_524336 | 3300042606 | Bacteria | 382683 |
| 122 | JGI24695J34938_10025893 | 3300002450 | Bacteria | 2796 |
| 123 | Ga0466704_205252 | 3300042643 | Bacteria | 4156 |
| 124 | Ga0466709_305056 | 3300042648 | Bacteria | 2241 |
| 125 | Ga0466727_193700 | 3300042655 | Bacteria | 75615 |
| 126 | Ga0466711_372501 | 3300042615 | Bacteria | 489210 |
| 127 | Ga0466723_050332 | 3300042618 | Unclassified | 14275 |
| 128 | Ga0466723_066610 | 3300042618 | Bacteria | 8258 |
| 129 | Ga0466723_080534 | 3300042618 | Bacteria | 2220 |
| 130 | Ga0466729_120945 | 3300042621 | Bacteria | 4178 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00266 | Aminotran_5 | Aminotransferase class-V | 66 | 433 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.