Protein Family IF08748
Metagenome
Isolate
126
Members
72
Samples
101
Scaffolds
157.66
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_050663|Ga0466735_050663_206_793
- Length
- 195 aa
- Sequence
- MSFFIFGYFIYFCVESYYVSHHHWCDVTYYLFFFKIEYIMHNADEQFEKLGLALPPAPKPMGVYKPSLVIDGKYMYLSGHGPVLEDGSQIKGRVGSDITPDEGKLAARQVGLTLLATVKASLGSLNRVKRVVKVLGMVNCTPEFESHPYVINGCSELFAAVWGDDNGVGTRSAVGVGSLPGNIPVEIEVLLEVAE
Sample Types
Isolate
19.8%
Metagenome
80.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.3%
Blattidae
26.2%
Kalotermitidae
20.0%
Rhinotermitidae
6.2%
Culicidae
6.2%
Unclassified
4.6%
Armadillidiidae
1.5%
Hodotermitidae
1.5%
Termopsidae
1.5%
Taxonomy
Archaea
0
Bacteria
122
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 10 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 11 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 12 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 13 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 14 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 15 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 16 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 17 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 18 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 21 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 22 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 23 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 28 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 29 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 30 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 31 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 32 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 33 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 34 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 35 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 36 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 37 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 38 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 39 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 40 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 41 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 42 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 43 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 44 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 45 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 46 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 47 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 48 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 49 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 50 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 51 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 52 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 53 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 54 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 55 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 56 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 57 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 58 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 59 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 60 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 61 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 62 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 63 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 64 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 65 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 66 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 67 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 68 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 69 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 70 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 71 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 72 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_220821 | 3300042659 | Bacteria | 2891 |
| 2 | Ga0466715_343918 | 3300042616 | Bacteria | 61776 |
| 3 | Ga0123356_10628774 | 3300010049 | Bacteria | 1240 |
| 4 | Ga0123354_10117153 | 3300010882 | Unclassified | 3469 |
| 5 | Ga0160471_109079 | 3300012812 | Bacteria | 1132 |
| 6 | Ga0466701_043895 | 3300042598 | Bacteria | 1799 |
| 7 | Ga0466700_156410 | 3300042600 | Bacteria | 13037 |
| 8 | Ga0466717_267378 | 3300042604 | Bacteria | 1439 |
| 9 | Ga0466722_117304 | 3300042609 | Bacteria | 122884 |
| 10 | JGI24702J35022_10025521 | 3300002462 | Bacteria | 3188 |
| 11 | Ga0072940_1172043 | 3300005200 | Bacteria | 4242 |
| 12 | Ga0466704_093764 | 3300042643 | Bacteria | 18620 |
| 13 | Ga0466690_408627 | 3300042590 | Bacteria | 146519 |
| 14 | Ga0466705_270862 | 3300042612 | Bacteria | 10479 |
| 15 | Ga0466710_435694 | 3300042613 | Bacteria | 1507 |
| 16 | Ga0466728_041125 | 3300042620 | Bacteria | 12445 |
| 17 | Ga0123353_10154869 | 3300010167 | Bacteria | 3655 |
| 18 | Ga0123353_10242334 | 3300010167 | Bacteria | 2800 |
| 19 | Ga0123353_10344151 | 3300010167 | Bacteria | 2251 |
| 20 | Ga0123353_11308254 | 3300010167 | Bacteria | 940 |
| 21 | Ga0466716_135343 | 3300042605 | Unclassified | 9819 |
| 22 | JGI24702J35022_10045764 | 3300002462 | Bacteria | 2331 |
| 23 | Ga0466734_083454 | 3300042623 | Bacteria | 2540 |
| 24 | Ga0466724_25433 | 3300042649 | Bacteria | 649431 |
| 25 | Ga0466694_062332 | 3300042594 | Bacteria | 2123 |
| 26 | Ga0466694_132758 | 3300042594 | Bacteria | 1066 |
| 27 | Ga0123353_10069732 | 3300010167 | Bacteria | 5647 |
| 28 | Ga0123353_11682039 | 3300010167 | Bacteria | 796 |
| 29 | Ga0160465_100001 | 3300012803 | Bacteria | 1272344 |
| 30 | Ga0466716_038967 | 3300042605 | Bacteria | 9075 |
| 31 | Ga0466716_402898 | 3300042605 | Bacteria | 26255 |
| 32 | JGI24702J35022_10031540 | 3300002462 | Bacteria | 2839 |
| 33 | Ga0466735_065309 | 3300042624 | Bacteria | 1568 |
| 34 | Ga0466703_042941 | 3300042636 | Bacteria | 11543 |
| 35 | Ga0466708_032901 | 3300042652 | Bacteria | 14614 |
| 36 | Ga0466690_015292 | 3300042590 | Bacteria | 19217 |
| 37 | Ga0466693_113860 | 3300042592 | Bacteria | 1540 |
| 38 | Ga0466705_239936 | 3300042612 | Bacteria | 10609 |
| 39 | Ga0466715_014319 | 3300042616 | Bacteria | 12681 |
| 40 | Ga0123357_10096629 | 3300009784 | Bacteria | 3826 |
| 41 | Ga0123356_10145198 | 3300010049 | Bacteria | 2346 |
| 42 | Ga0123353_10071339 | 3300010167 | Bacteria | 5581 |
| 43 | Ga0123353_12438008 | 3300010167 | Bacteria | 624 |
| 44 | Ga0466719_464142 | 3300042606 | Bacteria | 6362 |
| 45 | Ga0466722_064696 | 3300042609 | Bacteria | 2102 |
| 46 | Ga0072941_1461261 | 3300005201 | Bacteria | 1367 |
| 47 | Ga0160467_100069 | 3300012829 | Bacteria | 154006 |
| 48 | Ga0466697_195122 | 3300042611 | Bacteria | 1318 |
| 49 | Ga0466715_548749 | 3300042616 | Bacteria | 16600 |
| 50 | Ga0123356_10039521 | 3300010049 | Bacteria | 4395 |
| 51 | Ga0123353_10603014 | 3300010167 | Bacteria | 1569 |
| 52 | Ga0466707_218611 | 3300042601 | Bacteria | 1476 |
| 53 | Ga0466713_094776 | 3300042602 | Bacteria | 17485 |
| 54 | Ga0466716_283616 | 3300042605 | Bacteria | 2019 |
| 55 | JGI24702J35022_10008689 | 3300002462 | Bacteria | 5736 |
| 56 | Ga0466735_040960 | 3300042624 | Bacteria | 1345 |
| 57 | Ga0466703_057074 | 3300042636 | Bacteria | 3063 |
| 58 | Ga0466704_490817 | 3300042643 | Bacteria | 2466 |
| 59 | Ga0466656_158381 | 3300042550 | Bacteria | 1772 |
| 60 | Ga0466692_087151 | 3300042591 | Bacteria | 61940 |
| 61 | Ga0466691_033537 | 3300042593 | Bacteria | 3710 |
| 62 | Ga0466697_091894 | 3300042611 | Bacteria | 2999 |
| 63 | Ga0466711_427438 | 3300042615 | Bacteria | 3876 |
| 64 | Ga0466715_024951 | 3300042616 | Bacteria | 4537 |
| 65 | Ga0466729_120269 | 3300042621 | Bacteria | 1796 |
| 66 | Ga0123356_10303863 | 3300010049 | Bacteria | 1702 |
| 67 | Ga0123356_10364945 | 3300010049 | Bacteria | 1572 |
| 68 | Ga0466701_092276 | 3300042598 | Bacteria | 4483 |
| 69 | Ga0466719_110688 | 3300042606 | Bacteria | 18844 |
| 70 | Ga0466735_050663 | 3300042624 | Bacteria | 1745 |
| 71 | Ga0466703_176430 | 3300042636 | Bacteria | 35435 |
| 72 | Ga0466704_290991 | 3300042643 | Bacteria | 8563 |
| 73 | Ga0466709_289236 | 3300042648 | Bacteria | 4933 |
| 74 | Ga0466657_198630 | 3300042582 | Bacteria | 1531 |
| 75 | Ga0466711_417514 | 3300042615 | Bacteria | 2065 |
| 76 | Ga0466715_572944 | 3300042616 | Bacteria | 3515 |
| 77 | Ga0466728_468692 | 3300042620 | Bacteria | 1807 |
| 78 | Ga0123356_10426599 | 3300010049 | Bacteria | 1469 |
| 79 | Ga0123354_10066337 | 3300010882 | Bacteria | 5272 |
| 80 | Ga0466697_006688 | 3300042611 | Bacteria | 1146 |
| 81 | Ga0466697_048781 | 3300042611 | Bacteria | 2857 |
| 82 | Ga0466731_309308 | 3300042622 | Bacteria | 3503 |
| 83 | Ga0466703_344396 | 3300042636 | Bacteria | 4476 |
| 84 | Ga0466709_293204 | 3300042648 | Unclassified | 7169 |
| 85 | Ga0466724_45376 | 3300042649 | Bacteria | 30318 |
| 86 | Ga0160431_103479 | 3300012828 | Bacteria | 3214 |
| 87 | Ga0466692_152226 | 3300042591 | Unclassified | 1887 |
| 88 | Ga0466733_002254 | 3300042659 | Bacteria | 5049 |
| 89 | Ga0466723_251216 | 3300042618 | Bacteria | 3734 |
| 90 | Ga0466723_348124 | 3300042618 | Bacteria | 4225 |
| 91 | Ga0466729_013438 | 3300042621 | Bacteria | 20155 |
| 92 | Ga0123356_10052658 | 3300010049 | Bacteria | 3787 |
| 93 | Ga0123353_12617504 | 3300010167 | Bacteria | 596 |
| 94 | Ga0123354_10000036 | 3300010882 | Bacteria | 98370 |
| 95 | Ga0160464_109692 | 3300012805 | Bacteria | 867 |
| 96 | Ga0466706_177922 | 3300042599 | Bacteria | 3062 |
| 97 | JGI24702J35022_10039687 | 3300002462 | Bacteria | 2511 |
| 98 | JGI24705J35276_12230332 | 3300002504 | Bacteria | 3602 |
| 99 | Ga0466704_109310 | 3300042643 | Bacteria | 2508 |
| 100 | Ga0466692_127891 | 3300042591 | Bacteria | 34821 |
| 101 | Ga0466699_281171 | 3300042597 | Bacteria | 25408 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.